close all open/close all
first first   Salino3_00020 Salino3_00020

CDS information : Salino3_00010


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction694 / 239 / - [in whole cluster]
694 / 239 / - [in contig]
Locationcomplement(239..694) [in whole cluster]
complement(239..694) [in contig]
TypeCDS
Length456 bp (151 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative alkyl hydroperoxide reductase subunit C protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf1

close this sectionSequence

selected fasta
>[putative alkyl hydroperoxide reductase subunit C protein]
MKIGDLVEDFELPDENGEMRSLTGLLAEGPVVLFFYPAALTPGCTAEACHFRDLAAEFRA
AGGRPVGVSGDSVARQQEFSGRHTLGYPLLSDPEGGVRERFGVKRGLTVLPTKRATFVIG
TDRRVVEIVRSELRMSAHADRALAALRGLSA
selected fasta
>[putative alkyl hydroperoxide reductase subunit C protein]
ATGAAGATCGGTGACCTGGTCGAGGACTTCGAACTGCCCGACGAGAACGGCGAGATGCGG
AGCCTGACCGGCCTGCTCGCCGAGGGCCCGGTGGTGCTCTTCTTCTACCCGGCCGCGCTC
ACCCCGGGCTGCACCGCCGAGGCCTGCCACTTCCGCGACCTGGCCGCGGAGTTCCGCGCC
GCGGGCGGCCGCCCGGTCGGCGTCAGCGGCGACAGCGTGGCCCGCCAGCAGGAGTTCTCC
GGCAGGCACACCCTCGGCTACCCGCTGCTCTCCGACCCCGAGGGCGGCGTCCGGGAGCGC
TTCGGCGTGAAGCGGGGCCTGACGGTGCTGCCGACCAAGCGGGCCACCTTCGTGATCGGC
ACCGACCGGCGGGTCGTCGAGATCGTCCGCAGCGAACTGCGCATGAGCGCCCACGCGGAC
CGCGCCCTGGCGGCCCTGCGCGGGCTGTCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000866 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant (Domain)
 [3-127]  7.5e-29 PF00578
PF00578   AhpC-TSA
IPR012336 Thioredoxin-like fold (Domain)
 [1-151]  14.322 PS51352
PS51352   THIOREDOXIN_2
 [2-149]  6e-34 G3DSA:3.40.30.10
G3DSA:3.40.30.10   no description
 [2-149]  2.8e-44 SSF52833
SSF52833   Thioredoxin-like
SignalP
 [1-48]  0.137 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
first first   Salino3_00020 Salino3_00020