close all open/close all

CDS information : Salino3_00020


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction1,201 / 824 / - [in whole cluster]
1,201 / 824 / - [in contig]
Locationcomplement(824..1201) [in whole cluster]
complement(824..1201) [in contig]
TypeCDS
Length378 bp (125 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf2

close this sectionSequence

selected fasta
>[putative membrane protein]
MPQNISSPKLLAGLLAGAGLAHLAVPRVFDAMVPRVLPGPARTWTQASAAVEFALAAGVA
WPRTRRIAAKSAAAFFVGVFPGNVQMALDWRTKPAPLRNAALARLPLQAPLVLWAHQVGK
KAGRP
selected fasta
>[putative membrane protein]
ATGCCGCAGAACATCAGCTCCCCGAAACTCCTCGCCGGACTGCTCGCCGGAGCAGGCCTT
GCCCATCTCGCCGTCCCCCGGGTCTTCGACGCGATGGTGCCGCGCGTCCTGCCCGGCCCC
GCCCGCACCTGGACCCAGGCCAGCGCGGCGGTGGAGTTCGCGCTCGCCGCGGGGGTCGCC
TGGCCGCGGACCCGCCGGATCGCGGCGAAGTCGGCCGCCGCCTTCTTCGTCGGCGTCTTC
CCCGGCAACGTCCAGATGGCCCTCGACTGGCGCACGAAGCCCGCCCCGCTGCGCAACGCC
GCGCTGGCCCGGCTGCCGCTCCAGGCACCGCTCGTCCTGTGGGCGCACCAGGTCGGCAAG
AAGGCCGGCAGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-23]  0.926 Signal
Bacteria, Gram-negative   
 [1-26]  0.981 Signal
Eukaryota   
TMHMM No significant hit