close all open/close all

CDS information : Salino3_00030


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction1,418 / 1,918 / + [in whole cluster]
1,418 / 1,918 / + [in contig]
Location1418..1918 [in whole cluster]
1418..1918 [in contig]
TypeCDS
Length501 bp (166 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transcription regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf3

close this sectionSequence

selected fasta
>[putative transcription regulator]
MAHQPVSLDPLDRKILAALVANARRSFVEIGQEIGLSPAAVKRRVDRMRESEVITGFTTV
VRPSALGWRTEAYVEVFCEGAAPPRRLAEVARTYPEVVAAMTVTGGADALLHIRAADIEH
FEEVLERIRAEDFVRRTNSVIVLTHLLPGSPDAGASAPPRGAEEGS
selected fasta
>[putative transcription regulator]
ATGGCACATCAGCCGGTGTCCCTCGACCCACTCGACCGCAAGATCCTCGCCGCCCTGGTG
GCGAACGCCCGCCGCAGCTTCGTGGAGATCGGCCAGGAGATCGGCCTCTCCCCGGCGGCC
GTCAAACGCCGGGTCGACCGCATGCGCGAGAGCGAGGTCATCACCGGCTTCACCACCGTG
GTCCGCCCGAGCGCCCTCGGCTGGCGCACCGAGGCCTATGTCGAGGTCTTCTGCGAGGGC
GCCGCCCCGCCCCGCAGGCTCGCCGAGGTGGCCCGCACCTACCCGGAGGTGGTCGCCGCC
ATGACGGTCACCGGGGGTGCCGACGCCCTGCTGCACATCCGCGCCGCCGACATCGAGCAC
TTCGAGGAGGTGCTCGAACGCATCCGGGCCGAGGACTTCGTCCGCCGCACCAACAGCGTC
ATCGTCCTGACCCACCTGCTGCCCGGCTCGCCCGACGCCGGTGCCTCGGCCCCGCCGCGG
GGCGCCGAGGAGGGCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000485 HTH transcription regulator AsnC-type DNA-binding domain (Domain)
 [8-69]  36.307 PS50956
PS50956   HTH_ASNC_2
 [8-24]  6.5e-12 PR00033 [24-35]  6.5e-12 PR00033 [35-54]  6.5e-12 PR00033
PR00033   HTHASNC
IPR011008 Dimeric alpha-beta barrel (Domain)
 [68-149]  5.1e-15 SSF54909
SSF54909   Dimeric alpha+beta barrel
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [6-58]  1.6e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR019887 Transcription regulator AsnC-type, C-terminal (Domain)
 [74-143]  3.7e-15 PF01037
PF01037   AsnC_trans_reg
 [62-141]  3e-16 G3DSA:3.30.70.920
G3DSA:3.30.70.920   no description
IPR019888 Transcription regulator AsnC-type (Family)
 [8-115]  1.2e-36 SM00344
SM00344   helix_turn_helix ASNC type
SignalP
 [1-23]  0.24 Signal
Bacteria, Gram-positive   
TMHMM No significant hit