close all open/close all

CDS information : Salino3_00040


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction2,137 / 2,913 / + [in whole cluster]
2,137 / 2,913 / + [in contig]
Location2137..2913 [in whole cluster]
2137..2913 [in contig]
TypeCDS
Length777 bp (258 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative amidinotransferase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf4

close this sectionSequence

selected fasta
>[putative amidinotransferase]
MCEPRYFDVTYAINPWMTEGAPVDPALALAQWQELVDTYRSLGHTVELLEPVPGLPDMVF
AANGAAVVGGRVLGSRFYAPERVAEAPAHQAWFKAAGFDVREPEFVCEGEGDLVTVGRHL
LAGTGFRTALAAHQEAQEYLGIPVVSLHLTDPYFYHLDTALFALDDENIAYYPEAFSPGS
REALQRLYPDAILATREDAFAFGLNAVSDGRHVIVSPGAGQLTAQLAERGYEPIPVDLSE
LHKAGGSAKCCTQEVRPA
selected fasta
>[putative amidinotransferase]
ATGTGCGAGCCGCGCTACTTCGACGTGACCTACGCGATCAACCCCTGGATGACCGAGGGC
GCACCGGTCGACCCGGCCCTGGCCCTCGCCCAGTGGCAGGAGCTGGTCGACACCTACCGC
TCGCTCGGTCACACCGTGGAGCTCCTCGAACCGGTGCCCGGGCTGCCCGACATGGTCTTC
GCGGCCAACGGCGCCGCCGTGGTCGGCGGCCGGGTGCTCGGCTCCCGCTTCTACGCCCCC
GAGCGGGTGGCGGAGGCCCCGGCGCACCAGGCCTGGTTCAAGGCGGCGGGCTTCGACGTA
CGGGAGCCCGAGTTCGTCTGCGAGGGCGAGGGCGACCTGGTGACGGTCGGCCGGCACCTG
CTCGCGGGAACCGGCTTCCGCACCGCGCTCGCCGCGCACCAGGAGGCGCAGGAGTACCTT
GGGATCCCGGTGGTCAGCCTGCACCTGACCGACCCGTACTTCTACCACCTCGACACGGCG
CTGTTCGCCCTCGACGACGAGAACATCGCCTACTACCCGGAGGCCTTCTCGCCGGGCAGC
CGGGAGGCGCTGCAGCGGCTGTACCCGGACGCGATCCTGGCCACCCGCGAGGACGCCTTC
GCCTTCGGCCTCAACGCCGTCTCCGACGGCCGCCATGTGATCGTCTCGCCGGGCGCCGGG
CAGCTCACCGCCCAGCTCGCCGAGCGCGGCTACGAACCGATCCCCGTCGATCTCTCCGAA
CTGCACAAGGCCGGCGGAAGCGCCAAGTGCTGCACCCAGGAGGTACGTCCCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003198 Amidinotransferase (Family)
 [1-255]  7.6e-35 PF02274
PF02274   Amidinotransf
SignalP
 [1-28]  0.082 Signal
Eukaryota   
TMHMM No significant hit