close all open/close all

CDS information : Salino3_00050


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction2,910 / 4,139 / + [in whole cluster]
2,910 / 4,139 / + [in contig]
Location2910..4139 [in whole cluster]
2910..4139 [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative ornithine aminotransferase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf5

close this sectionSequence

selected fasta
>[putative ornithine aminotransferase]
MTAQPQNTGRRSSAELIHAEESRLAHNYHPLPVVVAKAEGAWVEDVEGRRYLDMLAGYSA
LNFGHRHPALIEAAHRQLDQLTLTSRAFHNDRLAGFAEQLSDLTGLDMTLPMNTGAEAVE
SGIKLARKWAYEVKGVAPDQANIVVAAGNFHGRTTTIVSFSDDPVARTGFGPFTPGFRTV
PYDDLAALEAAVDENTAAVLIEPIQGEAGVLIPTDGYLAGVRELTRRANVLFIADEIQSG
LGRTGTTLAVAHEAVLPDLLLLGKALGGGIVPVSAVVGRREVMSVLGPGQHGSTFGGNPL
AAAVGSAVVDLLETGEFQQRAKDLGVVLADRLSALVGHGVVGYRARGLWAGVDIDPAFGT
GREISERLMAEGVLVKDTHGSTIRFAPPLSISEEDLVSGLGALETVLAG
selected fasta
>[putative ornithine aminotransferase]
ATGACCGCTCAGCCCCAGAACACCGGCCGCCGCTCCTCGGCCGAGCTGATCCACGCCGAG
GAGTCCCGGCTCGCGCACAACTACCACCCGCTGCCGGTGGTGGTCGCGAAGGCCGAGGGC
GCCTGGGTCGAGGACGTCGAGGGACGCCGCTACCTGGACATGCTGGCCGGGTACTCGGCG
CTGAACTTCGGCCACCGCCACCCGGCGCTCATCGAGGCCGCGCACCGCCAGCTCGACCAG
CTCACGCTGACCTCGCGGGCCTTCCACAACGACCGCCTGGCGGGCTTCGCCGAACAGCTC
TCCGACCTCACCGGCCTCGACATGACGCTGCCGATGAACACCGGCGCGGAGGCCGTGGAG
AGCGGCATCAAGCTGGCCCGCAAATGGGCGTACGAGGTCAAGGGGGTCGCCCCGGACCAG
GCGAACATCGTGGTGGCCGCGGGCAACTTCCACGGCCGGACCACCACCATCGTCAGCTTC
TCCGACGACCCGGTGGCCCGCACCGGCTTCGGCCCCTTCACCCCGGGCTTCCGCACGGTG
CCCTACGACGACCTGGCCGCCCTGGAGGCCGCCGTCGACGAGAACACGGCCGCCGTGCTG
ATCGAGCCCATCCAGGGCGAGGCGGGGGTGCTCATCCCCACCGACGGCTACCTCGCCGGG
GTCCGGGAGCTGACCCGGCGCGCCAACGTCCTGTTCATCGCCGACGAGATCCAGTCGGGC
CTCGGCCGCACCGGCACCACCCTGGCCGTGGCGCACGAGGCCGTCCTGCCCGATCTGCTG
CTGCTCGGCAAGGCGCTCGGCGGCGGCATCGTGCCGGTCTCGGCGGTGGTCGGCAGGCGC
GAGGTGATGAGTGTGCTCGGCCCCGGCCAGCACGGCTCCACCTTCGGCGGCAACCCGCTG
GCGGCGGCCGTCGGCAGCGCGGTCGTCGACCTCCTGGAGACCGGCGAGTTCCAGCAGCGC
GCCAAGGACCTCGGCGTGGTGCTCGCCGACCGGCTCTCCGCCCTGGTCGGGCACGGGGTG
GTCGGCTACCGGGCGCGCGGCCTGTGGGCGGGCGTCGACATCGACCCGGCCTTCGGCACG
GGGCGTGAGATCAGCGAGCGGCTGATGGCCGAGGGCGTCCTGGTGAAGGACACCCACGGC
TCGACGATCCGGTTCGCCCCGCCGCTGTCGATCAGCGAGGAGGACCTGGTCTCCGGGCTC
GGCGCGCTGGAGACCGTACTCGCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005814 Aminotransferase class-III (Family)
 [35-355]  1.9e-99 PF00202
PF00202   Aminotran_3
 [232-269]  PS00600
PS00600   AA_TRANSFER_CLASS_3
IPR010164 Ornithine aminotransferase (Family)
 [14-407]  5.1e-146 TIGR01885
TIGR01885   Orn_aminotrans: ornithine--oxo-acid transaminase
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [68-313]  4.7e-85 G3DSA:3.40.640.10
G3DSA:3.40.640.10   no description
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [316-408]  1.5e-37 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   no description
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [7-408]  2.6e-122 SSF53383
SSF53383   PLP-dependent transferases
SignalP No significant hit
TMHMM No significant hit