close all open/close all

CDS information : Salino3_00060


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction5,267 / 4,218 / - [in whole cluster]
5,267 / 4,218 / - [in contig]
Locationcomplement(4218..5267) [in whole cluster]
complement(4218..5267) [in contig]
TypeCDS
Length1,050 bp (349 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative zinc-binding dehydrogenase family oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf6

close this sectionSequence

selected fasta
>[putative zinc-binding dehydrogenase family oxidoreductase]
MKAITVVPGDPGQVRVEEVQDAKPAQGELLVEGLLLGLCGTDADIVEEGYGWVPPGQQRL
LLGHESLGSVRDAPPGSGFAPGDLVAGIVRRPDPVPCEPCAHGSWDFCSNGRYTERGIKE
LDGYGSQLWRIEPEYAIKLDPRLGDCGVLLEPASVLAKAWEQIDRFVTRAPLRPRTVLVT
GAGPIGLLAALMGAQRALEVHVLDVNGDEPKAQLVKDLGATFHVGSLDDAKVTPELIVDT
TGHGPLVFDLTGKVAPSGVICLTGIASDSRRTPVPLDESNKEMVLENTVMFGSVNANRRN
FEQAAEALADADLRWLRRLITRKVPLSGFTPEFLHKRPEDVKVVVDLQA
selected fasta
>[putative zinc-binding dehydrogenase family oxidoreductase]
ATGAAGGCGATCACGGTCGTCCCCGGAGATCCCGGCCAGGTGCGGGTCGAGGAGGTCCAG
GACGCGAAGCCGGCCCAGGGCGAACTGCTCGTCGAGGGGCTGCTGCTCGGCCTCTGCGGC
ACCGACGCCGACATCGTCGAGGAGGGCTACGGCTGGGTGCCGCCCGGTCAGCAGCGCCTG
CTCCTCGGCCACGAGTCGCTGGGCTCGGTGCGGGACGCCCCGCCGGGCAGCGGCTTCGCC
CCGGGCGACCTAGTGGCGGGCATCGTACGGCGGCCCGACCCGGTGCCCTGCGAGCCCTGC
GCGCACGGCTCCTGGGACTTCTGCAGCAACGGCCGGTACACCGAGCGCGGCATCAAGGAG
CTGGACGGCTACGGCTCCCAGCTGTGGCGCATCGAGCCGGAGTACGCCATCAAGCTCGAC
CCCCGGCTCGGCGACTGCGGGGTCCTCCTGGAACCGGCCTCGGTGCTCGCCAAGGCCTGG
GAACAGATCGACCGCTTCGTCACCCGGGCCCCGCTGCGCCCGAGGACGGTCCTGGTCACC
GGCGCCGGGCCGATCGGCCTGCTGGCGGCGCTGATGGGCGCCCAGCGCGCCCTGGAGGTG
CACGTCCTGGACGTCAACGGGGACGAGCCCAAGGCGCAGCTGGTGAAGGACCTCGGCGCC
ACCTTCCACGTGGGCTCCCTGGACGACGCCAAGGTGACCCCGGAGCTGATCGTCGACACC
ACCGGGCACGGACCGCTGGTCTTCGACCTCACCGGCAAGGTGGCCCCCTCGGGGGTGATC
TGCCTGACCGGCATCGCCTCGGACTCCCGGCGCACCCCCGTGCCGCTGGACGAGAGCAAC
AAGGAGATGGTCCTCGAGAACACGGTGATGTTCGGCTCGGTCAACGCCAACCGGCGCAAC
TTCGAGCAGGCCGCCGAGGCGCTCGCGGACGCGGATCTGCGCTGGCTGCGGCGGCTGATC
ACCCGCAAGGTCCCGCTGAGCGGCTTCACCCCGGAGTTCCTGCACAAGCGGCCCGAGGAC
GTGAAGGTCGTCGTCGATCTGCAGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011032 GroES-like (Domain)
 [1-183]  1e-28 SSF50129
SSF50129   GroES-like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [27-137]  1.8e-10 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [188-313]  3.1e-10 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM No significant hit