close all open/close all

CDS information : Salino3_00070


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction5,560 / 7,008 / + [in whole cluster]
5,560 / 7,008 / + [in contig]
Location5560..7008 [in whole cluster]
5560..7008 [in contig]
TypeCDS
Length1,449 bp (482 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative glucose-6-phosphate 1-dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf7

close this sectionSequence

selected fasta
>[putative glucose-6-phosphate 1-dehydrogenase]
MTSQTNTQTGEDEDPVHLSERGMARARRWAWMIALGGFLFGYDTGVVSGALLFVRREFDL
NSFEQGSVVSILLLGAMVGALGAGRVADRLGRRRTLALEGVVFALGTVIVVTATGYPVLL
AGRIVLGLAIGGASATVPLYLSEVSPPQIRGRNLTLNQLMITTGILVSYLVDLSLASSGE
WRWMFGAGLVPALALVLCCTRLPESASWLIARGREDEARRAMRQVTEDEAGAAALVERFR
RRDEREARAAESAHVHGKGWRVLLAAPFRPALVVGLTVAAVQQLGGINTIIYYAPTIIEN
TGLTASNSIFYSVFIGLINLAMTLVAVRFVDRKGRRPLMLFSLTGMLLTLILMGLAFVAD
FSSVIALVFMVLYIASFAAGLGPVFWVLVGEVFPPSVRAVGSSAATSVNWLANFTVGLVF
LPLADAIGQGETFWIFAGVCAFGLWFVARYVPETRGASAEEIQEGLAKRFHRGGGTSAGR
GA
selected fasta
>[putative glucose-6-phosphate 1-dehydrogenase]
ATGACGAGCCAGACGAACACGCAGACCGGCGAGGACGAGGACCCCGTCCACCTCTCCGAG
CGGGGCATGGCCAGGGCCCGGCGCTGGGCCTGGATGATCGCGCTCGGCGGCTTCCTCTTC
GGCTACGACACCGGCGTCGTCTCCGGTGCCCTGCTCTTCGTACGCCGGGAGTTCGACCTG
AACTCCTTCGAGCAGGGCAGCGTGGTCAGCATCCTGCTGCTCGGCGCCATGGTGGGCGCG
CTCGGCGCGGGCCGGGTCGCCGACCGGCTCGGGCGGCGGCGGACCCTCGCCCTGGAAGGA
GTGGTCTTCGCCCTGGGCACCGTGATCGTGGTGACCGCCACCGGCTATCCGGTGCTGCTC
GCCGGGCGGATCGTGCTCGGCCTCGCGATCGGCGGTGCCTCGGCGACCGTGCCGCTCTAC
CTCTCCGAGGTCTCGCCGCCGCAGATCCGGGGCCGCAACCTCACCCTCAACCAGCTGATG
ATCACCACCGGCATCCTGGTCTCGTACCTCGTCGACCTCTCTCTGGCGAGCAGCGGGGAG
TGGCGCTGGATGTTCGGCGCCGGTCTCGTCCCGGCGCTCGCCCTGGTGCTCTGCTGCACC
CGGCTGCCCGAGTCGGCCTCCTGGCTGATCGCGCGGGGCCGCGAGGACGAGGCCCGCAGG
GCCATGCGGCAGGTCACCGAGGACGAGGCGGGTGCCGCCGCGCTCGTGGAGCGCTTCCGG
CGCCGGGACGAGCGGGAGGCCCGGGCCGCCGAGTCCGCGCATGTGCACGGCAAGGGCTGG
CGGGTGCTGCTCGCGGCGCCCTTCAGGCCCGCCCTGGTGGTGGGGCTCACGGTGGCGGCC
GTCCAGCAGCTCGGCGGCATCAACACGATCATCTACTACGCGCCCACCATCATCGAGAAC
ACCGGCCTGACCGCCTCCAACTCGATCTTCTACTCGGTCTTCATCGGCCTGATCAACCTG
GCCATGACCCTGGTCGCGGTGCGCTTCGTGGACCGCAAGGGGCGGCGGCCGCTGATGCTC
TTCTCGCTGACCGGGATGCTGCTCACGCTGATCCTGATGGGCCTCGCCTTCGTGGCGGAC
TTCAGCTCCGTCATCGCCCTCGTCTTCATGGTCCTGTACATCGCCTCCTTCGCCGCGGGG
CTCGGCCCGGTGTTCTGGGTCCTGGTGGGCGAGGTCTTCCCGCCGTCGGTCAGGGCGGTC
GGCTCCAGCGCGGCCACCTCCGTCAACTGGCTCGCCAACTTCACCGTCGGCCTGGTCTTC
CTGCCGCTCGCCGACGCCATCGGCCAGGGCGAGACCTTCTGGATCTTCGCCGGGGTCTGC
GCCTTCGGGCTGTGGTTCGTCGCGAGGTACGTACCCGAGACGCGCGGCGCGAGCGCCGAG
GAGATCCAGGAGGGGCTGGCGAAACGCTTCCACCGCGGGGGCGGGACGAGCGCGGGACGT
GGTGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003663 Sugar/inositol transporter (Family)
 [37-47]  1.3e-28 PR00171 [120-139]  1.3e-28 PR00171 [282-292]  1.3e-28 PR00171 [367-388]  1.3e-28 PR00171 [390-402]  1.3e-28 PR00171
PR00171   SUGRTRNSPORT
 [25-462]  4.1e-121 TIGR00879
TIGR00879   SP: MFS transporter, sugar porter (SP) family
IPR005828 General substrate transporter (Family)
 [29-464]  1.4e-116 PF00083
PF00083   Sugar_tr
IPR005829 Sugar transporter, conserved site (Conserved_site)
 [125-150]  PS00217
PS00217   SUGAR_TRANSPORT_2
 [83-100]  PS00216
PS00216   SUGAR_TRANSPORT_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-464]  5e-92 SSF103473
SSF103473   MFS general substrate transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [29-455]  60.634 PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [31-53]  Transmembrane (i-o) [68-87]  Transmembrane (o-i) [96-115]  Transmembrane (i-o) [119-141]  Transmembrane (o-i) [154-176]  Transmembrane (i-o) [181-203]  Transmembrane (o-i) [271-293]  Transmembrane (i-o) [308-330]  Transmembrane (o-i) [337-359]  Transmembrane (i-o) [364-386]  Transmembrane (o-i) [399-421]  Transmembrane (i-o) [426-448]  Transmembrane (o-i)
Transmembrane 12