close all open/close all

CDS information : Salino3_00080


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction7,005 / 8,204 / + [in whole cluster]
7,005 / 8,204 / + [in contig]
Location7005..8204 [in whole cluster]
7005..8204 [in contig]
TypeCDS
Length1,200 bp (399 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf8

close this sectionSequence

selected fasta
>[putative membrane protein]
MNPLKRLRGAARVDLAGLRGPMETAGLDAWQRLTTNFWPVLQQALAAGAAWYLARHVVDH
HLPLFAPIATIVALNAPRGERGVNAVRLMLGVSVGILLGEASMAVIGGHGYLTLGAAVFA
SMLAALVLGGERIVIAQASVSAIIAIATGTEEAGPQRLTDALIGTGVAIVVTQFLLPADP
VVLLHSAQKAFLKELSDSLYVTARDLDRADNSLSEKSLEQQRAVHNRLVELGVVRISSVD
TARRSPVWWRRKDRIVHESEHMGRLEVLGGSCLMLTRVAVSEGEEGRSRLAPVVSDLASI
LGRLAKDPGDVGTRQRAANRMLDLSRHVAEFADDPQAPAADSWPVVRLIAADVMMFAGVD
EDEAYAAAHEGAEQLGFPAPSVSPLKPMIKSTPLDKYTP
selected fasta
>[putative membrane protein]
GTGAACCCGCTCAAGCGGCTGCGCGGCGCGGCCCGGGTCGACCTCGCGGGGCTGCGCGGG
CCGATGGAGACCGCCGGTCTCGACGCCTGGCAGCGGCTCACCACCAACTTCTGGCCGGTG
CTCCAGCAGGCGCTCGCCGCGGGGGCCGCCTGGTACCTGGCCCGCCATGTGGTCGACCAC
CATCTGCCGCTCTTCGCCCCGATCGCCACCATCGTGGCCCTCAACGCCCCCCGCGGGGAG
CGCGGCGTCAACGCGGTACGGCTGATGCTCGGCGTCTCGGTGGGCATCCTGCTCGGCGAG
GCGTCCATGGCCGTCATCGGCGGCCACGGCTATCTGACCCTCGGGGCCGCGGTGTTCGCC
TCCATGCTGGCCGCGCTCGTCCTCGGCGGGGAGCGCATCGTCATCGCCCAGGCCAGCGTC
AGCGCGATCATCGCCATCGCCACCGGCACCGAGGAGGCGGGCCCCCAGCGGCTGACCGAC
GCGCTGATCGGCACCGGAGTCGCCATCGTCGTCACCCAGTTCCTGCTCCCGGCCGACCCG
GTGGTCCTGCTGCACAGCGCCCAGAAGGCCTTCCTCAAGGAGCTGTCCGACTCGCTGTAC
GTCACGGCCCGCGACCTCGACCGCGCGGACAACAGCCTCTCCGAGAAGTCCCTGGAGCAG
CAGCGCGCGGTCCACAACCGCCTGGTGGAACTCGGCGTGGTCCGGATCAGCAGTGTGGAC
ACCGCGCGCCGCTCGCCGGTCTGGTGGCGCAGGAAGGACCGCATCGTGCACGAGAGCGAG
CACATGGGCCGCCTGGAGGTGCTCGGCGGCAGCTGCCTGATGCTCACCCGGGTCGCGGTC
AGCGAGGGGGAGGAGGGCCGGAGCCGGCTCGCCCCGGTGGTGAGCGATCTCGCGAGCATC
CTCGGCCGCCTCGCCAAGGACCCCGGCGACGTGGGCACCCGCCAGCGGGCGGCCAACCGG
ATGCTCGACCTCTCCCGGCACGTGGCCGAGTTCGCGGACGACCCGCAGGCCCCCGCCGCC
GACTCCTGGCCGGTGGTGCGCCTGATCGCCGCCGACGTGATGATGTTCGCGGGCGTGGAC
GAGGACGAGGCCTACGCCGCCGCCCACGAGGGAGCCGAGCAACTCGGCTTCCCCGCGCCC
TCGGTGAGCCCCCTCAAGCCGATGATCAAGAGCACCCCGCTGGACAAGTACACGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit