close all open/close all

CDS information : Salino3_00090


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction9,460 / 8,477 / - [in whole cluster]
9,460 / 8,477 / - [in contig]
Locationcomplement(8477..9460) [in whole cluster]
complement(8477..9460) [in contig]
TypeCDS
Length984 bp (327 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative regulatory protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf9
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
H1ZZS9
NITE
Salino_00870
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)

close this sectionSequence

selected fasta
>hypothetical protein [putative regulatory protein]
MHGYTHLRLGPLDQLRVSVTAHQGATLLSLLADALGGRSQGVPERWRALVRQAAPEGSGA
VLAPLFAPAYSVIPDSITPTACMPDGDVASQCALLADLSPDTLLTELETEFPEFVPPQWQ
PVVERPQEWLRAYARLLGSVWDQFRPVWRGAGALLHRETERVGTAAVSGNLDVLLGSVSS
RFRYGEGSLRLPDQQAAEFSLDGRRLVLVPIVSGSGASMFALDRPDLVWIGYPMPGVGRL
WENCTEPHGGTDALALLLGPRRAALLRACEEPLTMGEIAVRIGCSPATLTYHCAQLEQAG
LLQRERRGQQVRLWRTERGHSVLDLLS
selected fasta
>hypothetical protein [putative regulatory protein]
ATGCACGGCTATACGCACTTGCGTCTCGGACCGCTGGACCAGCTGCGCGTCTCGGTGACC
GCACACCAGGGCGCCACCCTGCTCTCACTGCTCGCGGACGCCCTCGGCGGCAGGTCCCAG
GGGGTGCCCGAGCGGTGGCGGGCCCTGGTCAGGCAGGCGGCGCCGGAGGGCTCCGGGGCC
GTGCTCGCCCCGCTCTTCGCCCCCGCGTACTCGGTGATCCCGGACAGCATCACCCCCACC
GCCTGCATGCCCGACGGCGATGTGGCCAGCCAGTGCGCCCTGCTCGCCGACCTCTCGCCG
GACACCCTGCTGACCGAACTGGAGACGGAGTTCCCGGAGTTCGTCCCGCCCCAGTGGCAG
CCGGTGGTGGAGCGCCCCCAGGAGTGGCTGCGGGCCTACGCGCGGCTGCTCGGCTCGGTC
TGGGACCAGTTCCGGCCGGTGTGGCGGGGTGCCGGCGCCCTGCTGCACCGGGAGACCGAG
CGGGTGGGCACCGCCGCGGTGAGCGGGAACCTGGACGTGCTCCTCGGCTCGGTCAGCAGC
CGCTTCCGCTACGGGGAGGGCAGCCTGCGCCTGCCGGACCAGCAGGCGGCCGAGTTCAGC
CTCGACGGCAGGCGTCTCGTGCTGGTGCCGATCGTCTCGGGCAGCGGCGCCTCGATGTTC
GCCCTGGACCGGCCCGACCTGGTGTGGATCGGCTACCCGATGCCGGGAGTCGGGCGGCTC
TGGGAGAACTGCACCGAACCGCACGGCGGCACCGACGCGCTCGCGCTCCTGCTCGGCCCC
CGCCGCGCGGCCCTGCTGCGCGCCTGCGAGGAGCCGCTGACCATGGGCGAGATCGCCGTC
CGGATCGGCTGCAGCCCCGCCACCCTCACCTACCACTGCGCCCAGCTGGAGCAGGCGGGC
CTGCTCCAGCGCGAGCGCCGCGGCCAGCAGGTGCGGCTGTGGCGCACCGAACGCGGCCAC
TCCGTACTCGACCTGCTCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [252-323]  1.1e-11 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
SignalP No significant hit
TMHMM No significant hit