close all open/close all

CDS information : Salino3_00120


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction13,354 / 12,326 / - [in whole cluster]
13,354 / 12,326 / - [in contig]
Locationcomplement(12326..13354) [in whole cluster]
complement(12326..13354) [in contig]
TypeCDS
Length1,029 bp (342 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyltransferase
Product (GenBank)putative 3-oxoacyl-(acyl-carrier-protein ) synthase III
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • Orf12
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
P68795
PmId
[11959561] Purification, characterization, and identification of novel inhibitors of the beta-ketoacyl-acyl carrier protein synthase III (FabH) from Staphylococcus aureus. (Antimicrob Agents Chemother. , 2002)
ACC
H1ZZT2
NITE
Salino_00900
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)

close this sectionSequence

selected fasta
>putative acyltransferase [putative 3-oxoacyl-(acyl-carrier-protein ) synthase III]
MTGIGILGTGSYLPADRVSNAVVAERAGVTEEWIARKTGIRERRYAADSEATSDLAVEAA
RAALDSAGLDAAQLSWILLATSTPDSPQPATACLVQDRIGAVNAAAFDLNSVCSGFVFGL
VTAARLLAAPGPDGPGYGLVIGADTYSRIIDREDRRTAILFGDGAGAAVLGPVRSGHGLI
GSQLSTVGGTEDLIRVEAGGSRLPASEKTVAEGLHHFRMNGRGVSEFVAAELPPAVREVI
ASGGLRNSDIDHFIPHQANGVMLAKLLPELGLDQARTHLTVERHGNTSAASIAITLDEAH
RSGAFGDGDVLLLTGFGGGMSLGSALVRWDGPAARAHRKETV
selected fasta
>putative acyltransferase [putative 3-oxoacyl-(acyl-carrier-protein ) synthase III]
ATGACAGGAATAGGAATACTGGGCACCGGGTCGTATCTTCCTGCTGACAGAGTTTCCAAT
GCCGTCGTCGCCGAACGGGCCGGGGTCACCGAGGAGTGGATCGCGCGCAAGACCGGTATC
CGGGAACGCCGTTACGCCGCCGATTCGGAGGCGACATCCGACCTCGCGGTGGAGGCGGCC
CGGGCCGCGCTCGACTCGGCGGGACTGGACGCCGCCCAGCTGTCCTGGATCCTCCTGGCG
ACCTCCACCCCGGACAGCCCGCAGCCGGCCACCGCCTGCCTCGTGCAGGACCGCATCGGC
GCGGTGAACGCGGCGGCCTTCGACCTCAACTCGGTGTGCAGCGGCTTCGTCTTCGGCCTC
GTCACCGCCGCCCGGCTGCTCGCCGCACCGGGACCGGACGGCCCGGGATACGGACTGGTC
ATCGGCGCCGACACCTACTCCCGGATCATCGACCGCGAGGACCGGCGCACCGCGATCCTC
TTCGGCGACGGGGCGGGCGCCGCGGTCCTCGGACCGGTCAGATCCGGCCACGGCCTGATC
GGCTCGCAGCTCTCCACGGTGGGCGGCACCGAGGACCTCATCCGGGTCGAGGCGGGCGGC
AGCCGGCTGCCCGCCTCCGAGAAGACCGTCGCCGAGGGCCTGCACCACTTCCGTATGAAC
GGCCGCGGGGTGAGCGAATTCGTCGCCGCCGAACTGCCGCCCGCCGTACGGGAGGTGATC
GCCTCCGGCGGTCTGCGGAACTCCGACATCGACCACTTCATTCCGCATCAGGCCAACGGC
GTGATGCTCGCGAAGCTCCTGCCCGAACTCGGTCTCGACCAAGCGCGCACCCATCTGACC
GTGGAACGGCACGGCAACACCAGCGCCGCCTCCATCGCGATCACCCTCGACGAGGCGCAC
CGCTCGGGTGCCTTCGGCGACGGGGACGTGCTGCTGCTCACCGGGTTCGGCGGCGGTATG
TCGCTCGGCTCGGCGCTCGTGCGCTGGGACGGTCCGGCCGCCCGCGCCCATCGAAAGGAA
ACCGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH) (Family)
 [2-329]  33.994 MF_01815
MF_01815   FabH
 [5-329]  1e-89 TIGR00747
TIGR00747   fabH: 3-oxoacyl-[acyl-carrier-protein] synthase 3
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [242-329]  6.2e-29 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [107-187]  3.3e-22 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [2-163]  3.9e-49 G3DSA:3.40.47.10 [164-329]  3.3e-41 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [1-329]  9.1e-51 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit