close all open/close all

CDS information : Salino3_00200


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction74,150 / 85,324 / + [in whole cluster]
74,150 / 85,324 / + [in contig]
Location74150..85324 [in whole cluster]
74150..85324 [in contig]
TypeCDS
Length11,175 bp (3,724 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)slnA8
EC number
Keyword
Note
Note (GenBank)
  • SlnA8
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
H1ZZU0
NITE
Salino_00980
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)

close this sectionPKS/NRPS Module

12 methylmalonyl-CoA
13 malonyl-CoA
KS34..409
AT571..889
KR1194..1373
ACP1479..1549
KS1572..1947
AT2103..2422
DH2470..2632
ER2968..3273
KR3283..3463
ACP3568..3638

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MSNTNEDKLREYLKRATTDLRNARRRVRELEEPEPVAVVRMACRFPGEVASPEELWDLVA
EGREGISGFPEDRGWDLEALYDPDPDRAGTSYTQRGGFLQEVPQFDAQLFGISPREALAM
DPQQRLLLETAWEVLERAGIDPHSLKGSSTGVFVGASSSSYGGDLEEVPEGVEGYLGTGS
AAAVVSGRLAYTFGLEGPAVTVDTACSSSLVALHLAVQALRQNECGLALAAGVTVMSTPG
LFVEFSRQRGLASDGRCKAFGDTADGTGFAEGVGVLLLERLSDARRNGHEVLAVIRGSAV
NQDGASNGLTAPNGPSQRRVIKQALANARLEAAEIDAVEAHGTGTTLGDPIEAQALIATY
GKGRAPERPLWLGSVKSNIGHTQAAAGMAGVMKMIMAMRHGVLPRTLHADSPSTKIDWSA
GTVRLLQEDTPWERREDAPRRAGVSAFGVGGTNAHVILEQDTPAEPAPEAPAAEPAPRVL
DTRLLPWLVSGKNPGALRAQADRLHGFATASEAAPADIALSLATTRAALEQRGAVVAADR
AALASGLTALADGTSSPAVVQGTTLPGAGVVFVFPGQGSQWPGMAVELLDSSPVFAARLR
ECAEALAPYVDWSLLDVLRQADGAPGFDRVDVVQPALWAVMVSLAELWRASGVRPAAVIG
HSQGEIAAAAVSGALSLGDAAKVSALRAKALLALAGKGGMVSVAAPAAEVTTRIAAWGER
LAVASVNGPQSTVVSGEPGALDELLAACERDGVRARRINVDYASHGPQVETIREQVLTAL
DGIRPGRTGVPFLSTVTGEFVTGTELDAAYWYTNLRNTVRFEDAVRTLLAEGHGLFIEAS
AHPVLTVGVQETLDDAGQPAATLGSLRREEGGPGRFLTSLAEAWTRGAPVDWPRLLGGPG
TRTVELPTYAFQQERYWLESDPAAESAGGLPADEIEARFWDAVEREDLEELAGTLDVDED
GDHGLSRLLPALASWRRRRREGAEIDRWRYRVEFTRLGDPGQARLDGTWLLVVPEGADTL
AASCAGALERHGADTLTLPAATADRTALAETLGALAGTPLAGVLSLTGLAAEDPALLTLT
LAQALADAGLTAPLWCATRGAVSAVRGDAPATPAQAQVWGLGRVLALEAPRTWGGLIDLP
AAPDERALTRFVQALAASGEEDQIAVRDTGLYGRRLVRARLADRESGHEWRPRGTVLITG
GTGGVGAHAARRLASLGAPHLLLTSRRGPQAPGAAELIRELGELGARATVVACDAADREA
LAAALASVPEDAPLTAVLHAAGVPQSTPFDALTPEEFAEVTAGKVRGAEHLDALLGDTPL
DAFVLFSSNSGVWGAAGHTAYAAANAHLDALAEQRRARGLRATSLAWGAWGGGGIMDTEG
ARAYMAKRGVLEMEPATALTALLRAVDHEETFLAVADVDWARFAPGFTSGRPSPLLDGVP
EAREALRAAQPGEGQEGTYASEFAERLAGATEAEREEITLDLVRTEAAAVLGHTTLDAVA
PDRAFKDFGFDSLTAVDLRNRLTTATGLTLPATLVFDHPTPTALARFVRAEVLGTPDRSA
ERAGTSNTATDEPLAIVAMSCRYPGGVLSPEDLWQLVAEGRDAISGFPTDRGWDLGSLYD
PDPDALGTSYVREGGFVDSATRFDPGFFGISPREALTMDPQQRLLLETSWETFERAGIDP
ETLKGSSTGVFIGAGYPGYGEGMEMPEGSEGHMLFGASAAVVSGRVAYTFGLEGPAVTVD
TMCSSSLVALHLAAQALRSGECSMALAGGAMVMCSPGVFIGFSQQRGLSPDGRCKSFAEE
ADGTGWSEGVGVLLLERLSDAERNGHQVLAVIRGSATNQDGASNGLTAPNGPAQQRVIRQ
ALANAGLTGDQVDVVEAHGTGTTLGDPIEAQALLATYGQDHSAQSPLLLGSVKSNMGHAQ
AASGVAGVIKMVMAMRHGIVPRTLHIDNPSTEVDWNSGAVELLAESRDWPETGRPRRAAV
SSFGGSGTNAHLVLEQAPAPAPAEPRPAAEAPRLPLPWLLSGRGTPGLRAQAARLRDFFA
ADGTLDATDLAYSLTTTRAALETRGAVLAEDREGLLTALTALAEGSPAPGVVSGTAKPAK
TAFLFSGQGSQRPGAGRQLHAAFPVFAEALDELCAEFDRHLDRPLRTLLFAEEGTEDAAL
LDATRYTQPALFTLEVALFRQLAALGVRPGVLVGHSIGEIAAAHAAGVLSLADACALVAA
RGRLMQELPAGGVMISLRATEEEVLPLLAEVADRVSVAAVNGPASVVISGEAEAAREVAA
RLAEQGRKTRELTVSHAFHSPLMEPMLAEFRRVAEQLTYQAPTLPVVSNLTGEQLTEFGA
DYWVRHVREAVRFADGVRTVFGLGANTLIELGPGGVLTAMAQECVEDGGPAPLLVPALRK
DRPEPEAFLGALAQAWAHGVDVDWSGLYEGRAARRVDLPTYAFQHERFWPEPRTAGAADA
SGLGLTDAGHPLLGAATELADGAGLLFTGRLSPETQPWLADHAVAGTVILPGTAFVELAV
RAGDEAGTGRLEELTLEAPLPLPERGGVQIQVRVGEADSAGRRPVAVHSRPENAAGRPWT
RHASGELAPAAGESAPGLGAWPPPGAEALDVGGFYAGAAEVGYGFGPSFQGLTAAWKHPE
SGEVFAEVVLPEPQQAQAGKYVLHPALLDAALHGMRLGDFVEQTGEARLPFLFNGVHLHA
AGASALRVRIAKAGTDTIAVTATDTAGHPVATLDSLVLRPVATASLQQSAGEAEGLFRLD
WVPVPAPTTAAAGTWAVLGADTPGLADTLRTAGAAASYPDVAAMKAALTAGDPLPDTVLL
PLGPQTGAQEAGADAVRESTARLLGHLKDWFADTSLEDVRLAVLTRGAVATRTGEDVTDL
AHAPAWGLVRSAQTENPGRLVLLDLDPKAEAPAAALPGALAATAEADEPGAALRGETLLV
PRLVTTAGSGSLTLPEEAAWTLDTRARGTLDNLGLLPRPEAEAPLAENTVRIAVHAAGLN
FRDVMIALGMYPGEAFLGSEAAGVVTETGPGVTSLAVGDRVMGMIPHAFGPLAVADHRMV
ARIPAGWTFERAASVPAAFLTAAYALRDLADLKRGEKVLVHAAAGGVGMAAVQLAQHLGA
EVFATASKGKWDALRAAGLDEAHIASSRDADFEEYFSASSDGKGMDVVLDSLSGELVDAS
LRLLAKGGRFIEMGKTDIRDPEQIARDHGGALYRAFDLAEAGPERTGEMLAELAALFDSG
ALTPLPVRSWDIRRAPEAFRLMSRAQHIGKIVLTVPQRWDPEGTVLITGGTGTLGALLAR
HLVTAHGVRHLVLAGRRGPEAPGAAELVAEIAELGGTAQVVACDAADRERLAAVLAEIPA
ERPLRAVVHTAGIVDDGVLGSLDAERLAAVLRPKADAALNLHELTRDLELTDFVLYSSAA
GVSGNSGQANYAAANAFLDALAHHRRAQGLPARSLAWGMWEPAGGMTADLAETDVARMTR
GGVTPLTPETGLALFDAAARLDEALYVPVRLDPASLGGQSGGAVPALYRALVRTPVRRSA
QAAAAASEPEELLGRLAGRTAAQAAEILLDLVRTHVCAVLGITDPRTVEADRAFKDIGFD
SLTAVELRNRLNSATGLRLPATLIFDFPSPGELVDHLRTELAPEAAGAQDTGTGSEEADE
QQIRRVLSSVPVRRLREAGLLDALLELGAAPVGETAAQQPQQAAAIAEMDVDALVSLALD
NSNS
selected fasta
>polyketide synthase [polyketide synthase]
TTGAGCAACACCAATGAAGACAAGCTCCGCGAATATCTGAAGCGGGCCACCACCGACCTG
CGCAACGCGCGCAGGCGGGTACGGGAGCTGGAAGAGCCGGAGCCGGTCGCCGTGGTGCGC
ATGGCCTGCCGCTTCCCCGGCGAGGTCGCGAGCCCGGAAGAGCTGTGGGACCTGGTCGCC
GAGGGCCGGGAGGGCATCTCCGGCTTCCCCGAGGACCGCGGCTGGGACCTGGAGGCGCTG
TACGACCCGGACCCGGACCGGGCCGGGACCTCGTACACCCAGCGGGGCGGATTCCTTCAG
GAGGTCCCGCAGTTCGACGCCCAGCTCTTCGGGATCTCGCCGCGTGAGGCGCTGGCCATG
GATCCGCAGCAGCGGCTGCTCCTGGAGACCGCCTGGGAGGTCCTGGAGCGGGCCGGTATC
GACCCGCACTCGCTGAAGGGCAGCAGCACCGGCGTCTTCGTCGGCGCCTCCTCCTCCAGC
TACGGCGGCGACCTGGAGGAGGTCCCGGAGGGCGTCGAGGGCTACCTCGGCACCGGCAGC
GCGGCGGCCGTGGTCTCCGGCCGCCTCGCCTACACCTTCGGCCTCGAAGGCCCCGCGGTC
ACCGTCGACACCGCCTGCTCCTCCTCGCTCGTGGCCCTGCACCTCGCGGTGCAGGCGCTG
CGGCAGAACGAGTGCGGGCTCGCCCTGGCCGCGGGCGTCACCGTGATGTCCACGCCGGGG
CTCTTCGTCGAGTTCAGCCGCCAGCGCGGGCTCGCCTCCGACGGCCGCTGCAAGGCCTTC
GGGGACACCGCGGACGGCACCGGCTTCGCGGAGGGCGTCGGCGTGCTCCTCCTGGAGCGG
CTCTCCGACGCCCGCCGCAACGGGCACGAGGTCCTGGCCGTGATCCGCGGCTCCGCCGTC
AACCAGGACGGCGCGAGCAACGGCCTCACCGCGCCCAACGGCCCCTCCCAGCGCCGCGTC
ATCAAGCAGGCGCTCGCCAACGCCCGCCTGGAGGCCGCCGAGATCGACGCGGTCGAGGCG
CACGGCACCGGCACCACCCTCGGCGACCCCATCGAGGCCCAGGCCCTCATCGCCACCTAC
GGCAAGGGCCGCGCGCCCGAACGCCCGCTCTGGCTCGGCTCGGTGAAGTCGAACATCGGC
CACACCCAGGCCGCCGCGGGCATGGCCGGCGTGATGAAGATGATCATGGCCATGCGCCAC
GGCGTCCTGCCCAGGACCCTGCACGCCGACAGCCCCAGCACCAAGATCGACTGGTCCGCG
GGCACCGTCCGGCTGCTCCAGGAGGACACCCCCTGGGAGCGGCGCGAGGACGCCCCCCGC
CGCGCGGGCGTCTCCGCCTTCGGCGTCGGCGGCACCAACGCCCACGTCATCCTCGAACAG
GACACCCCCGCCGAGCCCGCCCCCGAGGCCCCGGCCGCCGAGCCCGCCCCGCGCGTCCTG
GACACCCGGCTGCTTCCCTGGCTGGTCTCCGGCAAGAACCCCGGCGCCCTGCGCGCCCAG
GCCGACCGGCTGCACGGCTTCGCCACCGCCTCCGAGGCCGCGCCCGCCGACATCGCGCTC
TCGCTGGCCACCACCCGTGCCGCCCTGGAGCAGCGCGGCGCCGTGGTCGCCGCGGACCGT
GCCGCCCTCGCCTCCGGCCTGACCGCCCTCGCCGACGGCACCTCCAGCCCGGCCGTGGTC
CAGGGCACCACCCTGCCCGGCGCCGGAGTCGTCTTCGTCTTCCCCGGTCAGGGTTCGCAG
TGGCCGGGTATGGCGGTCGAACTCCTGGACTCCTCGCCGGTGTTCGCGGCGCGGTTGCGG
GAGTGCGCCGAGGCGCTGGCCCCGTACGTGGACTGGTCGCTGCTGGATGTGCTGCGGCAG
GCGGACGGCGCCCCGGGCTTCGACCGGGTGGATGTCGTGCAGCCCGCGCTGTGGGCCGTG
ATGGTCTCGCTCGCCGAACTCTGGCGCGCCTCGGGGGTGCGCCCCGCCGCGGTCATCGGC
CACTCGCAGGGCGAGATCGCCGCCGCGGCCGTCTCCGGTGCGCTGTCGCTCGGCGACGCC
GCGAAGGTCTCGGCGCTGCGGGCCAAGGCGCTGCTCGCGCTCGCGGGCAAGGGCGGCATG
GTCTCGGTCGCGGCCCCCGCCGCCGAGGTCACCACCCGTATCGCGGCCTGGGGCGAACGC
CTCGCCGTCGCCTCCGTGAACGGCCCGCAGTCCACCGTGGTCTCCGGCGAACCGGGCGCC
CTGGACGAACTCCTCGCCGCCTGCGAGCGGGACGGGGTGCGCGCCCGCCGCATCAACGTC
GACTACGCCTCGCACGGCCCCCAGGTCGAGACCATCCGCGAGCAGGTCCTCACCGCCCTC
GACGGGATCCGGCCGGGCCGCACCGGGGTGCCCTTCCTCTCCACCGTCACCGGCGAGTTC
GTCACCGGCACCGAGCTGGACGCCGCGTACTGGTACACCAACCTGCGCAACACCGTCCGC
TTCGAGGACGCCGTACGCACCCTGCTCGCCGAGGGCCACGGGCTCTTCATCGAGGCGAGC
GCGCACCCGGTGCTGACCGTCGGCGTGCAGGAGACCCTCGACGACGCCGGGCAGCCCGCC
GCGACCCTCGGCAGCCTGCGCCGCGAGGAGGGCGGCCCCGGGCGCTTCCTCACCTCGCTC
GCCGAGGCCTGGACCCGCGGCGCCCCCGTCGACTGGCCGCGCCTCCTCGGCGGCCCCGGC
ACCCGTACCGTCGAACTCCCCACCTACGCCTTCCAGCAGGAGCGCTACTGGCTGGAGTCC
GACCCCGCCGCCGAGAGCGCGGGCGGGCTGCCCGCCGACGAGATCGAGGCCCGCTTCTGG
GACGCCGTCGAGCGCGAGGACCTGGAGGAACTCGCCGGGACCCTGGACGTCGACGAGGAC
GGCGACCACGGCCTGAGCAGGCTGCTTCCCGCCCTCGCCTCCTGGCGCCGGCGCCGCCGC
GAGGGCGCCGAGATCGACCGCTGGCGCTACCGCGTCGAGTTCACCCGGCTCGGCGACCCG
GGGCAGGCCCGGCTCGACGGCACCTGGCTGCTCGTCGTCCCCGAGGGCGCGGACACCCTC
GCCGCCTCCTGCGCCGGGGCCCTGGAGCGGCACGGCGCCGACACCCTGACGCTGCCCGCC
GCGACCGCCGACCGCACCGCCCTCGCCGAGACCCTCGGCGCCCTGGCCGGCACCCCCCTC
GCGGGCGTGCTCTCCCTCACCGGCCTGGCCGCCGAGGACCCGGCCCTGCTCACCCTCACC
CTGGCCCAGGCCCTCGCCGACGCGGGACTCACCGCCCCGCTGTGGTGCGCCACCCGGGGC
GCCGTCTCCGCCGTCCGCGGCGACGCGCCCGCCACCCCCGCCCAGGCCCAGGTCTGGGGC
CTCGGCCGCGTCCTCGCCCTGGAGGCGCCCCGTACCTGGGGCGGCCTGATCGACCTGCCC
GCCGCACCCGACGAGCGGGCCCTCACCCGCTTCGTCCAGGCCCTCGCCGCGAGCGGCGAG
GAGGACCAGATCGCGGTACGCGACACCGGGCTCTACGGACGCAGGCTGGTCCGCGCCCGG
CTCGCCGACCGCGAGAGCGGCCACGAATGGCGGCCGCGCGGCACCGTCCTGATCACCGGC
GGCACCGGGGGAGTGGGCGCCCACGCCGCCCGTAGGCTCGCCTCGCTCGGCGCCCCCCAC
CTGCTGCTCACCAGCCGCCGCGGCCCCCAGGCGCCCGGCGCCGCCGAACTCATCCGCGAA
CTCGGCGAGTTGGGCGCCCGCGCCACGGTCGTCGCCTGCGACGCCGCCGACCGCGAGGCG
CTGGCCGCCGCGCTGGCCTCGGTGCCCGAGGACGCCCCGCTGACCGCCGTCCTGCACGCC
GCGGGCGTCCCCCAGTCCACCCCCTTCGACGCGCTCACCCCCGAGGAGTTCGCCGAGGTC
ACCGCGGGCAAGGTGCGCGGCGCCGAGCACCTCGACGCCCTGCTCGGGGACACCCCGCTC
GACGCCTTCGTGCTCTTCTCCTCCAACTCCGGGGTCTGGGGCGCCGCGGGCCACACCGCC
TACGCCGCCGCCAATGCCCACCTCGACGCCCTCGCCGAGCAGCGCCGCGCCCGCGGACTG
CGGGCCACCTCGCTGGCCTGGGGCGCCTGGGGCGGCGGCGGGATCATGGACACCGAGGGC
GCCCGCGCCTACATGGCCAAGCGCGGCGTCCTGGAGATGGAGCCCGCGACCGCGCTCACC
GCCCTGCTGCGCGCCGTCGACCACGAGGAGACCTTCCTCGCTGTCGCCGACGTCGACTGG
GCCCGCTTCGCCCCCGGCTTCACCTCCGGCCGCCCGAGCCCCCTGCTCGACGGCGTCCCC
GAGGCCCGCGAGGCACTGCGCGCCGCACAGCCCGGTGAGGGCCAGGAGGGCACCTACGCC
TCCGAGTTCGCCGAGCGCCTGGCCGGTGCCACCGAGGCCGAGCGCGAGGAGATCACCCTG
GACCTGGTGCGCACCGAGGCCGCCGCGGTCCTCGGGCACACCACCCTGGACGCCGTCGCC
CCCGACCGCGCCTTCAAGGACTTCGGCTTCGACTCGCTGACCGCCGTCGACCTGCGCAAC
CGCCTGACCACGGCCACCGGTCTCACCCTCCCCGCCACCCTGGTCTTCGACCACCCCACC
CCGACGGCGCTGGCCCGCTTCGTCCGCGCCGAGGTCCTCGGCACCCCCGACCGGTCCGCC
GAGCGGGCCGGGACCTCCAACACCGCCACCGACGAACCCCTCGCCATCGTCGCCATGAGC
TGCCGCTACCCGGGCGGGGTGCTCTCGCCCGAGGACCTGTGGCAGCTGGTCGCCGAGGGC
CGCGACGCCATCTCCGGCTTCCCCACCGACCGCGGCTGGGACCTGGGCTCGCTCTACGAC
CCGGACCCGGACGCGCTCGGCACCAGCTATGTGCGCGAGGGCGGATTCGTCGACAGCGCC
ACCCGTTTCGACCCCGGCTTCTTCGGGATCTCGCCGCGCGAGGCGCTCACCATGGACCCG
CAGCAGCGGCTCCTCCTGGAGACCTCCTGGGAGACCTTCGAGCGCGCCGGGATCGACCCG
GAGACCCTCAAGGGCAGCAGCACCGGCGTGTTCATCGGCGCCGGATACCCCGGCTACGGC
GAGGGCATGGAGATGCCCGAGGGCTCCGAGGGGCACATGCTCTTCGGCGCCTCCGCCGCC
GTCGTCTCCGGCCGTGTCGCCTACACCTTCGGCCTCGAAGGGCCCGCGGTCACCGTCGAC
ACCATGTGCTCCTCCTCCCTGGTCGCCCTGCACCTCGCCGCGCAGGCGCTGCGCAGCGGG
GAGTGCTCGATGGCGCTGGCGGGCGGCGCGATGGTGATGTGCTCGCCCGGCGTCTTCATC
GGCTTCAGCCAGCAGCGCGGACTCTCCCCGGACGGCCGCTGCAAGTCCTTCGCCGAGGAG
GCGGACGGCACCGGCTGGTCCGAGGGCGTCGGCGTGCTGCTCCTGGAACGCCTCTCGGAC
GCCGAGCGCAACGGCCACCAGGTTCTCGCCGTCATCCGCGGCTCCGCCACCAACCAGGAC
GGCGCCTCCAACGGGCTGACCGCCCCCAACGGCCCCGCCCAGCAGCGCGTCATCCGCCAG
GCCCTCGCCAACGCCGGCCTCACCGGCGACCAGGTCGACGTGGTCGAGGCGCACGGCACC
GGCACCACCCTCGGCGACCCCATCGAGGCGCAGGCGCTGCTCGCCACCTACGGGCAGGAC
CACAGCGCGCAGAGCCCGCTGCTGCTCGGCTCGGTGAAGTCCAACATGGGCCACGCGCAG
GCCGCTTCGGGCGTCGCGGGCGTCATCAAGATGGTGATGGCGATGCGGCACGGCATCGTC
CCGCGCACCCTGCACATCGACAACCCCAGCACCGAGGTCGACTGGAACTCCGGGGCGGTG
GAACTCCTCGCCGAGTCCCGCGACTGGCCCGAGACCGGCCGCCCCCGCCGCGCCGCCGTC
TCCTCCTTCGGCGGCAGCGGCACCAACGCCCACCTCGTCCTGGAGCAGGCCCCCGCACCG
GCGCCCGCCGAGCCCCGGCCCGCGGCCGAGGCACCCCGGCTGCCGCTGCCCTGGCTGCTC
TCCGGCCGCGGCACCCCGGGACTGCGCGCCCAGGCCGCCCGCCTGCGCGACTTCTTCGCC
GCCGACGGGACCCTGGACGCCACCGACCTCGCGTACTCGCTCACCACCACCCGCGCGGCC
CTGGAGACCCGCGGCGCGGTGCTCGCCGAGGACCGCGAGGGCCTGCTCACCGCGCTGACC
GCGCTCGCCGAGGGCAGCCCCGCACCGGGCGTCGTCTCCGGCACCGCCAAGCCCGCGAAG
ACCGCCTTCCTCTTCTCCGGGCAGGGCAGCCAGCGTCCCGGCGCGGGCCGCCAACTGCAC
GCCGCCTTCCCGGTGTTCGCCGAGGCCCTCGACGAACTCTGCGCGGAGTTCGACCGCCAC
CTCGACCGTCCGCTGCGCACCCTCCTCTTCGCCGAGGAGGGCACCGAGGACGCCGCGCTC
CTGGACGCCACCCGCTACACCCAGCCCGCGCTCTTCACCCTCGAAGTGGCCCTCTTCCGC
CAGCTGGCCGCCCTCGGCGTACGGCCCGGCGTCCTGGTCGGCCACTCCATCGGCGAGATC
GCGGCCGCCCATGCCGCCGGGGTGCTCTCCCTGGCCGACGCCTGCGCCCTGGTCGCCGCC
CGCGGCCGCCTGATGCAGGAACTCCCGGCGGGCGGCGTGATGATCTCGCTGCGCGCCACG
GAGGAGGAGGTCCTGCCGCTGCTCGCCGAGGTGGCGGACCGCGTCTCGGTCGCCGCCGTC
AACGGGCCCGCTTCGGTGGTGATCTCCGGCGAGGCCGAGGCCGCCCGGGAGGTCGCCGCC
CGGCTCGCCGAGCAGGGCCGCAAGACCCGCGAACTGACCGTCTCGCATGCCTTCCACTCG
CCGCTCATGGAGCCGATGCTCGCCGAATTCCGGCGCGTGGCCGAGCAGTTGACCTACCAG
GCGCCCACCCTGCCGGTGGTCTCCAACCTCACCGGCGAGCAGCTCACCGAGTTCGGCGCC
GACTACTGGGTCCGGCACGTACGCGAGGCGGTCCGCTTCGCCGACGGCGTCCGCACCGTC
TTCGGGCTCGGCGCCAACACCCTGATCGAGCTGGGCCCCGGCGGCGTGCTCACCGCCATG
GCCCAGGAGTGCGTCGAGGACGGCGGCCCCGCCCCGCTGCTCGTGCCCGCCCTGCGCAAG
GACCGCCCCGAGCCCGAGGCCTTCCTCGGCGCCCTCGCCCAGGCCTGGGCGCACGGCGTC
GACGTCGACTGGAGCGGACTGTACGAGGGCCGCGCGGCCCGCCGCGTCGACCTGCCCACC
TACGCCTTCCAGCACGAGCGCTTCTGGCCCGAGCCGCGCACCGCGGGCGCCGCCGACGCG
AGCGGTCTCGGACTCACCGACGCCGGGCACCCCCTGCTCGGCGCCGCCACCGAACTCGCC
GACGGCGCGGGCCTGTTGTTCACCGGCAGGCTCTCCCCGGAGACCCAGCCCTGGCTCGCC
GACCACGCGGTCGCCGGCACCGTCATCCTGCCCGGCACCGCCTTCGTCGAGCTCGCCGTA
CGGGCCGGTGACGAGGCGGGGACCGGCCGCCTGGAGGAACTCACCCTGGAGGCCCCGCTG
CCGCTGCCCGAGCGCGGCGGCGTCCAGATCCAGGTGCGCGTCGGCGAGGCCGACAGCGCG
GGCCGCCGCCCGGTGGCCGTCCACTCCCGGCCGGAGAACGCCGCCGGACGCCCCTGGACC
CGGCACGCCAGCGGTGAACTCGCCCCCGCCGCAGGGGAGTCGGCCCCCGGACTCGGCGCC
TGGCCGCCGCCCGGCGCCGAGGCCCTCGACGTCGGCGGCTTCTACGCCGGTGCCGCCGAG
GTCGGCTACGGCTTCGGCCCCTCCTTCCAGGGCCTGACCGCGGCCTGGAAGCACCCGGAG
AGCGGCGAGGTCTTCGCCGAGGTCGTGCTGCCCGAACCGCAGCAGGCCCAGGCGGGCAAG
TACGTACTGCACCCCGCCCTGCTCGACGCCGCCCTGCACGGCATGCGCCTCGGCGACTTC
GTCGAGCAGACCGGCGAGGCACGGCTGCCCTTCCTCTTCAACGGGGTCCACCTGCACGCC
GCGGGCGCCTCGGCGCTGCGGGTGCGCATCGCCAAGGCCGGTACGGACACCATCGCGGTG
ACCGCCACCGACACCGCGGGCCACCCCGTCGCCACCCTCGACTCCCTGGTCCTGCGCCCG
GTCGCCACCGCCTCGCTCCAGCAGTCCGCGGGCGAGGCCGAGGGCCTGTTCCGCCTCGAC
TGGGTCCCCGTACCGGCGCCCACCACGGCCGCCGCGGGCACCTGGGCGGTCCTCGGCGCC
GACACCCCCGGCCTCGCGGACACCCTGCGCACCGCGGGCGCGGCCGCCTCGTACCCCGAT
GTCGCCGCCATGAAGGCCGCGCTCACCGCGGGCGACCCGCTGCCGGACACCGTGCTCCTC
CCGCTCGGCCCGCAGACCGGGGCCCAGGAGGCCGGTGCGGACGCCGTACGGGAGTCCACC
GCCCGCCTCCTCGGCCACCTCAAGGACTGGTTCGCCGACACCTCCCTGGAGGACGTCCGG
CTCGCGGTCCTCACCCGCGGCGCCGTCGCCACCCGCACCGGCGAGGACGTCACCGACCTC
GCGCACGCCCCCGCCTGGGGCCTGGTCCGCTCCGCGCAGACCGAGAACCCCGGCCGCCTG
GTCCTGCTCGACCTCGACCCAAAGGCCGAGGCGCCCGCCGCCGCGCTGCCCGGTGCCCTC
GCCGCGACCGCCGAGGCGGACGAGCCCGGGGCCGCATTGCGCGGCGAGACGCTGCTCGTC
CCGCGCCTGGTGACCACCGCCGGATCGGGCTCCCTGACGCTGCCCGAGGAGGCCGCCTGG
ACCCTGGACACCCGGGCCCGCGGCACCCTGGACAACCTCGGCCTGCTGCCCCGCCCGGAG
GCGGAGGCACCGCTCGCCGAGAACACCGTACGGATCGCCGTGCACGCCGCCGGACTCAAC
TTCCGCGATGTGATGATCGCCCTCGGCATGTACCCGGGGGAGGCCTTCCTCGGCAGCGAG
GCCGCGGGCGTGGTCACCGAGACCGGCCCCGGCGTCACCTCGCTCGCCGTCGGCGACCGC
GTCATGGGCATGATCCCGCACGCCTTCGGGCCGCTCGCCGTCGCCGACCACCGCATGGTC
GCCCGGATCCCGGCGGGCTGGACCTTCGAGCGCGCCGCCTCGGTACCGGCCGCCTTCCTC
ACCGCCGCCTACGCGCTGCGCGACCTCGCGGACCTCAAGCGGGGCGAGAAGGTGCTCGTC
CACGCCGCCGCGGGCGGTGTCGGCATGGCCGCCGTGCAGCTCGCCCAGCACCTCGGCGCC
GAGGTCTTCGCCACCGCCAGCAAGGGCAAGTGGGACGCGCTGCGCGCCGCCGGACTCGAC
GAGGCGCACATCGCCTCCTCCCGCGACGCCGACTTCGAGGAGTACTTCTCCGCCTCCTCC
GACGGCAAGGGCATGGACGTCGTCCTCGACTCGCTCAGCGGCGAACTCGTCGACGCCTCG
CTGCGCCTGCTGGCCAAGGGCGGCCGCTTCATCGAGATGGGCAAGACCGACATCCGCGAC
CCGGAGCAGATCGCACGCGACCACGGCGGCGCCCTCTACCGGGCCTTCGACCTCGCCGAG
GCCGGACCCGAGCGCACCGGCGAGATGCTCGCCGAACTCGCCGCGCTCTTCGACTCCGGA
GCCCTCACCCCGCTGCCGGTCCGCAGCTGGGACATCCGGCGCGCCCCCGAGGCCTTCCGC
CTGATGAGCCGCGCCCAGCACATCGGCAAGATCGTGCTCACCGTCCCGCAGCGCTGGGAC
CCCGAGGGCACCGTCCTGATCACCGGCGGCACCGGCACCCTCGGCGCCCTGCTCGCCCGC
CACCTGGTCACCGCACACGGCGTACGCCACCTGGTGCTCGCCGGGCGGCGCGGACCCGAG
GCCCCCGGCGCGGCCGAACTGGTCGCCGAGATCGCCGAGTTGGGCGGTACGGCCCAGGTC
GTCGCCTGCGACGCGGCGGACCGGGAGCGGCTGGCCGCGGTGCTGGCCGAGATCCCCGCC
GAGCGCCCGCTGCGCGCCGTCGTGCACACCGCGGGCATCGTCGACGACGGCGTCCTCGGC
TCCCTGGACGCCGAACGCCTCGCCGCCGTACTGCGGCCCAAGGCGGACGCCGCCCTCAAC
CTGCACGAGCTGACCCGCGACCTGGAGCTGACCGACTTCGTCCTCTACTCCTCCGCCGCG
GGCGTCTCCGGCAACTCCGGCCAGGCCAACTACGCCGCCGCCAACGCCTTCCTGGACGCC
CTGGCCCACCACCGCCGCGCCCAGGGGCTGCCCGCCCGCTCGCTGGCCTGGGGCATGTGG
GAACCGGCGGGCGGCATGACCGCCGACCTCGCCGAGACCGACGTGGCGCGGATGACCCGC
GGCGGCGTCACCCCGCTCACCCCGGAGACCGGCCTCGCCCTCTTCGACGCCGCCGCCCGG
CTCGACGAGGCCCTGTACGTGCCCGTACGGCTCGACCCGGCCTCGCTCGGCGGACAGAGC
GGCGGCGCGGTACCCGCGCTCTACCGGGCCCTGGTCCGCACCCCGGTGCGGCGCAGCGCC
CAGGCCGCCGCCGCGGCCTCCGAGCCCGAGGAACTGCTCGGCCGCCTCGCCGGGCGCACC
GCCGCCCAGGCCGCCGAGATCCTCCTCGATCTGGTCCGCACCCACGTCTGCGCGGTGCTC
GGCATCACCGACCCCCGTACCGTCGAGGCCGACCGCGCCTTCAAGGACATCGGCTTCGAC
TCGCTGACCGCGGTCGAACTGCGCAACCGCCTGAACAGCGCCACCGGGCTCCGGCTGCCC
GCCACCCTGATCTTCGACTTCCCCTCCCCGGGCGAACTCGTCGACCATCTGCGCACCGAA
CTGGCCCCCGAGGCCGCCGGCGCCCAGGACACCGGCACCGGCTCCGAGGAGGCCGACGAG
CAGCAGATCCGGCGCGTCCTGTCGAGCGTTCCGGTGCGGCGGCTGCGGGAGGCCGGACTC
CTCGACGCGCTCCTCGAGCTCGGCGCCGCCCCGGTCGGCGAGACGGCCGCGCAGCAACCG
CAGCAGGCCGCGGCGATCGCCGAGATGGACGTCGACGCCCTCGTCTCGCTGGCCCTCGAC
AACAGCAACTCCTGA
[12] KS34..409
[12] AT571..889
[12] methylmalonyl-CoA762..766
[12] KR1194..1373
[12] ACP1479..1549
[13] KS1572..1947
[13] AT2103..2422
[13] malonyl-CoA2296..2300
[13] DH2470..2632
[13] ER2968..3273
[13] KR3283..3463
[13] ACP3568..3638
[12] KS100..1227
[12] AT1711..2667
[12] methylmalonyl-CoA2284..2298
[12] KR3580..4119
[12] ACP4435..4647
[13] KS4714..5841
[13] AT6307..7266
[13] malonyl-CoA6886..6900
[13] DH7408..7896
[13] ER8902..9819
[13] KR9847..10389
[13] ACP10702..10914

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [761-879]  1.5e-69 G3DSA:3.40.366.10 [2296-2410]  3.4e-75 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1507-1522]  PS00012 [3596-3611]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1479-1549]  20.298 PS50075 [3568-3638]  21.279 PS50075
PS50075   ACP_DOMAIN
 [1478-1552]  4.2e-20 G3DSA:1.10.1200.10 [3568-3642]  1.1e-21 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1472-1588]  1e-24 SSF47336 [3560-3655]  1.5e-23 SSF47336
SSF47336   ACP-like
 [1482-1548]  1.9e-11 PF00550 [3571-3637]  7.5e-14 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [2956-3102]  8.4e-31 SSF50129
SSF50129   GroES-like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [2988-3043]  6.6e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1194-1372]  1e-61 PF08659 [3283-3461]  3.8e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  2.1e-95 PF00109 [1572-1821]  1.1e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-409]  5.1e-48 PF02801 [1829-1947]  2.9e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [571-889]  2.5e-108 PF00698 [2103-2422]  3.1e-63 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-29]  7.6e-11 PF08990
PF08990   Docking
 [2-36]  7.4e-06 SSF101173
SSF101173   Docking domain B of the erythromycin polyketide synthase (DEBS)
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [569-871]  5.7e-65 SSF52151 [2100-2387]  5.4e-69 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [696-761]  9.1e-19 SSF55048 [2230-2295]  4e-17 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [36-296]  6.2e-86 G3DSA:3.40.47.10 [297-460]  2.7e-62 G3DSA:3.40.47.10 [1575-1833]  4.6e-88 G3DSA:3.40.47.10 [1834-1999]  6.9e-62 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [26-460]  7.8e-104 SSF53901 [1564-1999]  2.3e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1194-1414]  4.8e-37 G3DSA:3.40.50.720 [3103-3198]  1e-19 G3DSA:3.40.50.720 [3283-3497]  4.4e-33 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [573-870]  2.9e-117 SM00827 [2104-2402]  3.8e-122 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1480-1552]  1.9e-33 SM00823 [3569-3641]  3.2e-33 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2470-2632]  9.6e-84 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-463]  1.1e-216 SM00825 [1574-1999]  1.2e-222 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1194-1373]  9.8e-54 SM00822 [3283-3463]  5e-57 SM00822
SM00822   no description
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [2968-3273]  5.3e-186 SM00829
SM00829   Enoylreductase
SignalP No significant hit
TMHMM No significant hit