close all open/close all

CDS information : Salino3_00220


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction92,379 / 92,765 / + [in whole cluster]
92,379 / 92,765 / + [in contig]
Location92379..92765 [in whole cluster]
92379..92765 [in contig]
TypeCDS
Length387 bp (128 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)putative epoxide hydrolase
Gene
Gene (GenBank)slnBI
EC number
Keyword
  • tetrahydropyran ring
Note
Note (GenBank)
  • SlnBI
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
H1ZZU2
NITE
Salino_01000
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
[26377145] Enzymology of Pyran Ring A Formation in Salinomycin Biosynthesis. (Angew Chem Int Ed Engl. , 2015)

close this sectionSequence

selected fasta
>putative cyclase [putative epoxide hydrolase]
MQDEQKRKEIVAEYFRKVNEGDVDAIVEMFTENATIEDPVGKDVREGRAAQREYFNSNVT
AEVTIEPGHLSAGQDGKSVAVALAAEMTNILDPNRTRVKINAVDVFTLTPEGKIDSMRVF
WGMTDIGV
selected fasta
>putative cyclase [putative epoxide hydrolase]
ATGCAGGACGAGCAGAAGCGCAAGGAGATCGTCGCGGAATACTTCCGCAAGGTGAACGAG
GGCGATGTCGACGCCATCGTCGAGATGTTCACCGAGAACGCCACCATCGAGGACCCGGTC
GGCAAGGATGTCCGCGAGGGCCGCGCAGCGCAGCGCGAGTACTTCAACAGCAATGTCACC
GCCGAGGTCACCATCGAGCCGGGACACCTGTCGGCGGGTCAGGACGGCAAGTCCGTCGCC
GTCGCCCTGGCCGCGGAGATGACCAACATCCTCGACCCCAACCGCACCCGTGTGAAGATC
AACGCCGTCGACGTCTTCACCCTCACCCCCGAGGGCAAGATCGACAGCATGCGCGTGTTC
TGGGGCATGACCGACATCGGCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [11-114]  3.1e-13 PF12680
PF12680   SnoaL_2
SignalP No significant hit
TMHMM No significant hit