close all open/close all

CDS information : Salino3_00230


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction92,807 / 93,604 / + [in whole cluster]
92,807 / 93,604 / + [in contig]
Location92807..93604 [in whole cluster]
92807..93604 [in contig]
TypeCDS
Length798 bp (265 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)putative thioesterase
Gene
Gene (GenBank)slnDI
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • SlnDI
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)
ACC
H1ZZU3
NITE
Salino_01010
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)

close this sectionSequence

selected fasta
>putative type II thioesterase [putative thioesterase]
MSTQRTQGSQDADDELWVRRFHPAPEKPVRLVCLPHAGGSASFFFPFSAALAPHADVLAI
QYPGRQDRRGEPLLGTVQELTDAVLEALRPWHDRPLVFFGHSMGAVLSFELARRFEREGA
PVQGLIASGRRAPTVHREENVHQRGDDALIAEIRALSGTDTGLLADEELLRMVLPAIRSD
YKAIETYRYRPDGTQPPLTSPVSVLTGESDPRVSIPEAQAWQELSSGKFTFRSFPGGHFY
LTPRQAEVTRAVAEDLAAFARVPAN
selected fasta
>putative type II thioesterase [putative thioesterase]
ATGAGCACGCAGCGCACACAGGGCAGTCAGGACGCCGACGACGAGCTGTGGGTACGGCGC
TTCCACCCCGCACCCGAGAAGCCGGTACGCCTGGTGTGCCTGCCGCACGCCGGTGGCTCC
GCGTCCTTCTTCTTCCCGTTCTCGGCAGCGCTCGCCCCTCACGCCGACGTCCTGGCGATC
CAGTACCCGGGCCGCCAGGACCGGCGGGGCGAGCCGCTGCTCGGCACCGTCCAGGAGCTG
ACCGACGCCGTCCTCGAGGCGCTGCGGCCCTGGCACGACCGGCCGCTGGTGTTCTTCGGC
CACAGCATGGGCGCGGTGCTCTCCTTCGAGCTGGCCCGCCGCTTCGAGCGCGAGGGCGCC
CCGGTGCAGGGGCTCATCGCCTCCGGGCGCCGGGCCCCCACGGTGCACCGCGAGGAGAAC
GTGCACCAGCGCGGCGACGACGCGCTGATCGCGGAGATCCGCGCGCTGAGCGGCACGGAC
ACCGGGCTGCTCGCCGACGAGGAGCTGCTGCGGATGGTGCTGCCCGCGATCCGCAGCGAC
TACAAGGCCATCGAGACCTACCGCTACCGGCCAGACGGGACCCAGCCGCCGCTGACCTCG
CCCGTCAGCGTGCTCACCGGGGAGTCCGACCCGCGGGTCAGCATTCCCGAGGCGCAGGCC
TGGCAGGAGCTCAGCAGCGGGAAGTTCACCTTCCGCAGCTTCCCCGGCGGCCACTTCTAT
CTGACGCCGCGCCAGGCGGAGGTGACCCGCGCGGTGGCCGAGGACCTGGCCGCCTTCGCC
CGGGTCCCGGCGAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [30-254]  7.9e-56 PF00975
PF00975   Thioesterase
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [32-256]  2.7e-05 SM00824
SM00824   Thioesterase
SignalP No significant hit
TMHMM No significant hit