close all open/close all

CDS information : Salino3_00250


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction94,936 / 94,655 / - [in whole cluster]
94,936 / 94,655 / - [in contig]
Locationcomplement(94655..94936) [in whole cluster]
complement(94655..94936) [in contig]
TypeCDS
Length282 bp (93 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)putative ferridoxin protein
Gene
Gene (GenBank)slnE
EC number
Keyword
Note
Note (GenBank)
  • SlnE
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
H1ZZU5
NITE
Salino_01030
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Family/Domain
FD
IPR001080

close this sectionSequence

selected fasta
>putative ferredoxin [putative ferridoxin protein]
MSAAGTPTAREETGGGSRDGDWEVSVDRLSCTGTGMCVHAAPAFFGLVGGRSQALGSPVE
PDETVLDAAENCPLEAIRVTERATGRVLAPEEF
selected fasta
>putative ferredoxin [putative ferridoxin protein]
GTGAGCGCCGCGGGGACGCCGACCGCGCGGGAGGAGACCGGCGGCGGGTCGCGGGACGGC
GACTGGGAGGTCAGCGTCGACCGGCTGTCCTGCACCGGCACCGGCATGTGCGTCCACGCG
GCGCCCGCCTTCTTCGGCCTGGTGGGCGGCCGTTCGCAGGCGCTCGGCTCCCCCGTGGAG
CCCGACGAGACGGTGCTGGACGCCGCCGAGAACTGCCCCCTGGAGGCCATCCGCGTCACC
GAACGGGCCACCGGACGGGTGCTGGCGCCCGAGGAGTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [26-37]  6.1e-05 PR00352 [37-47]  6.1e-05 PR00352 [65-77]  6.1e-05 PR00352
PR00352   3FE4SFRDOXIN
SignalP No significant hit
TMHMM No significant hit