close all open/close all

CDS information : Salino3_00260


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction96,156 / 94,933 / - [in whole cluster]
96,156 / 94,933 / - [in contig]
Locationcomplement(94933..96156) [in whole cluster]
complement(94933..96156) [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450
Gene
Gene (GenBank)slnF
EC number
Keyword
Note
Note (GenBank)
  • SlnF
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
Q59523
PmId
[7808395] Characterization and expression of a P-450-like mycinamicin biosynthesis gene using a novel Micromonospora-Escherichia coli shuttle cosmid vector. (Mol Gen Genet. , 1994)
ACC
Q331R5
PmId
[21069297] Identification and characterization of gerPI and gerPII involved in epoxidation and hydroxylation of dihydrochalcolactone in Streptomyces species KCTC 0041BP. (Arch Microbiol. , 2011)
ACC
Q9KHJ7
NITE
Enter_00180
PmId
[11137817] Cloning, sequencing and analysis of the enterocin biosynthesis gene cluster from the marine isolate 'Streptomyces maritimus': evidence for the derailment of an aromatic polyketide synthase. (Chem Biol. , 2000)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)
ACC
H1ZZU6
NITE
Salino_01040
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450]
MPASKSSCPVAHGPVRDFPFTPVDGLVIEPVLAELRREEPISRIRLPYGGEAWLATRYQD
VRNALADPRLSRAAVVNADVPRRQEMQVGPEGIMYMDPPDHSRLRRLLTKAFTRRRVEML
RPRVAEIAAELAGDLAAQGSGGDLVSTFSWPLPTRVICELLGVPYEDREIFSRGADALMQ
GDTLPHAEFTSRINELCLYLAKLIAQRRAQPTEDMLTALIQARDEDDRLSEQELISISVV
LLAGGHETTANQITNFLYTLLRHPGQLALLREKPELMPQAVDELMRYIPLGTGHHAAMIA
TEDLEIGGQRIAEGESVYVHIHSANRDGEFFENPDELDLGREDNHHMGFGHGVHFCVGAQ
LARMELAVAVESVLDRFPTLELDIEDEAIRWRSSLLVRGPLALPVRW
selected fasta
>putative cytochrome P450 [putative cytochrome P450]
ATGCCTGCCTCAAAGTCTTCCTGTCCCGTCGCGCACGGGCCCGTGCGTGATTTCCCCTTC
ACCCCCGTCGACGGCCTGGTCATCGAGCCGGTCCTGGCCGAGCTGCGCCGCGAGGAGCCG
ATCAGCCGGATCCGCCTGCCCTACGGCGGCGAGGCCTGGCTCGCCACGCGCTACCAGGAC
GTACGCAACGCGCTCGCGGACCCGCGGCTCAGCCGCGCGGCGGTGGTGAACGCGGACGTA
CCGCGGCGCCAGGAGATGCAAGTGGGTCCCGAGGGGATCATGTACATGGACCCGCCCGAC
CACTCCCGGCTGCGGCGCCTGCTCACCAAGGCCTTCACCCGGCGGCGGGTGGAGATGCTG
CGGCCCCGGGTGGCCGAGATCGCCGCCGAACTCGCCGGGGACCTGGCCGCCCAGGGCAGC
GGCGGGGACCTGGTGTCCACCTTCTCCTGGCCGCTGCCCACCCGGGTGATCTGCGAACTG
CTCGGGGTGCCCTACGAGGACCGCGAGATCTTCAGCCGCGGCGCGGACGCGCTGATGCAG
GGCGACACCCTGCCGCACGCCGAGTTCACCTCCCGTATCAACGAACTCTGCCTGTATCTG
GCCAAGTTGATCGCCCAGCGCCGGGCGCAGCCGACCGAGGACATGCTCACCGCGCTGATC
CAGGCCCGGGACGAGGACGACCGGCTCAGCGAGCAGGAGCTGATCTCGATCTCCGTGGTG
CTCCTCGCCGGCGGCCACGAGACCACCGCGAACCAGATCACCAACTTCCTCTACACGCTG
CTGCGCCACCCCGGCCAACTCGCCCTGTTACGCGAGAAACCCGAGCTGATGCCGCAGGCC
GTGGACGAGCTGATGCGCTACATCCCGCTCGGCACCGGGCACCACGCCGCCATGATCGCG
ACGGAGGACCTGGAGATCGGCGGGCAGCGGATCGCCGAGGGTGAGTCCGTGTATGTACAC
ATACACTCGGCCAACCGGGACGGCGAGTTCTTCGAGAACCCGGACGAGCTCGACCTCGGC
CGCGAGGACAACCACCACATGGGCTTCGGCCACGGGGTCCACTTCTGCGTGGGCGCCCAA
CTCGCCCGGATGGAACTGGCGGTGGCCGTCGAATCCGTACTGGACCGCTTCCCCACCCTG
GAGCTGGACATCGAGGACGAGGCGATCCGCTGGCGCTCCAGCCTGCTGGTCCGCGGGCCG
CTCGCGCTGCCGGTGCGCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [7-407]  6.80004680300024e-101 SSF48264
SSF48264   Cytochrome_P450
 [244-261]  5.99999702863249e-07 PR00385 [279-290]  5.99999702863249e-07 PR00385 [347-356]  5.99999702863249e-07 PR00385 [356-367]  5.99999702863249e-07 PR00385
PR00385   P450
 [206-379]  4.00000000000001e-26 PF00067
PF00067   p450
 [22-407]  1.10000000000001e-112 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [96-107]  3.10001307370206e-57 PR00359 [143-159]  3.10001307370206e-57 PR00359 [160-175]  3.10001307370206e-57 PR00359 [198-220]  3.10001307370206e-57 PR00359 [279-290]  3.10001307370206e-57 PR00359 [298-325]  3.10001307370206e-57 PR00359 [326-341]  3.10001307370206e-57 PR00359 [347-356]  3.10001307370206e-57 PR00359 [356-367]  3.10001307370206e-57 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [349-358]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit