close all open/close all

CDS information : Salino3_00270


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction96,333 / 97,292 / + [in whole cluster]
96,333 / 97,292 / + [in contig]
Location96333..97292 [in whole cluster]
96333..97292 [in contig]
TypeCDS
Length960 bp (319 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding protein
Product (GenBank)putative ABC transporter ATP-binding protein
Gene
Gene (GenBank)slnTI
EC number
Keyword
Note
Note (GenBank)
  • SlnTI
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
Q54406
PmId
[8196549] An ABC-transporter from Streptomyces longisporoflavus confers resistance to the polyether-ionophore antibiotic tetronasin. (Mol Microbiol. , 1994)
ACC
H1ZZU7
NITE
Salino_01050
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)
Family/Domain
FD
IPR003439

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding protein [putative ABC transporter ATP-binding protein]
MAPNEYAITAEGLTKDFGKFRALDGLDLSVRTGEVHGFLGPNGAGKSTTIRALLGLLKPT
AGKATLLGKDPWADAVEVHHKLAYVPGDVSLWRNLSGGEAIDLFGTLRGGIDKSRKAELI
ERFQLDPTKKCRAYSKGNRQKVALVSAFASDTELLILDEPTSGLDPLMEAVFQECVKEVK
AQGRTVLLSSHILAEVEALCDRVSIVRRGRTVESGSLQELRHLTRTSLSVETQRPATGLA
ELAGVHNAVAEGNHLKLDVDNAQLEPVLAKVLGFGVVSLNSAPPTLEELFMRHYGDAPAE
DGDGGKDGADRAKAEAATR
selected fasta
>putative ABC transporter ATP-binding protein [putative ABC transporter ATP-binding protein]
TTGGCGCCCAACGAGTACGCAATCACCGCGGAAGGCCTCACCAAGGACTTCGGCAAGTTC
CGCGCGCTGGACGGTCTCGACCTGTCCGTGCGCACGGGAGAGGTCCACGGCTTCCTCGGC
CCCAACGGTGCGGGTAAATCCACCACCATCCGTGCCCTGCTCGGCCTGCTCAAGCCCACC
GCGGGCAAGGCCACCCTGCTCGGCAAGGACCCCTGGGCCGACGCCGTCGAGGTGCACCAC
AAGCTCGCCTACGTCCCCGGCGACGTCAGCCTGTGGCGCAACCTCAGCGGCGGCGAGGCC
ATCGACCTGTTCGGGACGCTGCGCGGCGGCATCGACAAGTCCCGCAAGGCGGAGCTGATC
GAGCGCTTCCAGCTCGACCCGACCAAGAAGTGCCGCGCCTACTCCAAGGGCAACCGGCAG
AAGGTCGCCCTGGTCTCCGCCTTCGCCAGCGACACCGAGCTGCTCATCCTCGACGAGCCC
ACCTCCGGACTCGACCCCCTGATGGAGGCCGTCTTCCAGGAGTGCGTCAAGGAGGTCAAG
GCGCAGGGCCGCACCGTCCTGCTCTCCAGCCACATCCTCGCCGAGGTCGAGGCGCTCTGC
GACCGCGTCAGCATCGTGCGCCGCGGCCGCACCGTGGAATCGGGCTCCCTGCAGGAGCTG
CGCCACCTCACCCGCACCTCGCTCAGCGTCGAGACGCAGCGCCCGGCCACCGGGCTCGCG
GAGCTGGCCGGCGTCCACAACGCGGTGGCCGAGGGCAACCACCTCAAACTCGACGTGGAC
AACGCCCAGTTGGAGCCCGTACTCGCCAAGGTCCTCGGCTTCGGCGTGGTCTCCCTGAAC
AGCGCCCCGCCCACCCTGGAGGAGCTGTTCATGCGCCACTACGGCGACGCCCCCGCCGAG
GACGGCGACGGCGGCAAGGACGGCGCGGACCGCGCGAAGGCGGAGGCGGCCACCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [47-162]  2e-13 PF00005
PF00005   ABC_tran
 [8-233]  20.862 PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [32-210]  1.8e-10 SM00382
SM00382   ATPases associated with a variety of cellula
IPR017871 ABC transporter, conserved site (Conserved_site)
 [134-148]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit