close all open/close all

CDS information : Salino3_00310


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction100,184 / 101,638 / + [in whole cluster]
100,184 / 101,638 / + [in contig]
Location100184..101638 [in whole cluster]
100184..101638 [in contig]
TypeCDS
Length1,455 bp (484 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative epoxidase
Product (GenBank)epoxidase
Gene
Gene (GenBank)slnC
EC number
Keyword
Note
Note (GenBank)
  • SlnC
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
B5M9L6
NITE
Lasal_00200
PmId
[22506807] Sequential enzymatic epoxidation involved in polyether lasalocid biosynthesis. (J Am Chem Soc. , 2012)
[23796908] Biosynthetic machinery of ionophore polyether lasalocid: enzymatic construction of polyether skeleton. (Curr Opin Chem Biol. , 2013)
ACC
B5M9L6
NITE
Lasal2_00240
PmId
[19025863] Analysis of specific mutants in the lasalocid gene cluster: evidence for enzymatic catalysis of a disfavoured polyether ring closure. (Chembiochem. , 2008)
ACC
Q846W9
NITE
Monen_00220
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
ACC
H1ZZV1
NITE
Salino_01090
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)

close this sectionSequence

selected fasta
>putative epoxidase [epoxidase]
MPAADGRVTHLMTGETHAVVLGGGLTGMLTSAVLARHLDKVTVIERDVLPEGPELRKGVP
QARHAHLLWSGGARAIDSVLPGTVKQLIAEGAHRLYLPRDVVWLTPHGWQHRFSGSQFMV
TCSRALLDWVVRRQALAEPKITVRQETEVLGLLGGAGQVTGVRLRDRSGESTELAADLVV
DAGGRASALRRWLPELGLDQVEEDVVDSGIAYATRVFKAPAPVAQGFPMVNIAAAPGLGK
PGQNGALVPIEDGKWLVTLAGTRGGEPPTDDDSFLDFARGLRHPVLADLLERAEPLGPVK
GSRSTVNRRLYYDRVANWPDGLLVLGDALAAFNPVYGHGMSCSALSAKALDAELGRSGLA
PGMVQAVLQKVAKVVDDPWLLATTQDICYPGTKVTAQDPRIAPRGDQEQQFADLLSTAAL
HDPVVSAAAMQVTALAAPVSSLESPHLVAALRKGKAHEPLTAPPFKDAELAVLDGDAAGA
AASA
selected fasta
>putative epoxidase [epoxidase]
GTGCCCGCGGCCGACGGAAGGGTCACCCATCTCATGACCGGAGAAACGCACGCCGTCGTT
CTCGGCGGCGGTCTGACCGGAATGCTGACATCCGCCGTCCTCGCACGGCACCTGGACAAG
GTCACCGTCATCGAGCGCGATGTGCTGCCCGAAGGCCCCGAACTGCGCAAGGGCGTACCC
CAGGCCCGCCACGCCCACCTCCTGTGGTCCGGCGGCGCCCGCGCCATCGACTCCGTACTG
CCCGGCACCGTCAAGCAGCTCATCGCCGAGGGCGCGCACCGCCTCTACCTGCCGCGGGAC
GTGGTCTGGCTGACCCCGCACGGCTGGCAGCACCGCTTCTCCGGCAGCCAGTTCATGGTC
ACCTGCAGCCGCGCCCTGCTCGACTGGGTGGTGCGCCGCCAGGCCCTCGCCGAGCCGAAG
ATCACCGTGCGGCAGGAGACCGAGGTGCTCGGCCTGCTCGGCGGCGCCGGGCAGGTCACC
GGTGTCCGGCTGCGGGACAGGTCCGGCGAGAGCACCGAGCTCGCCGCCGACCTGGTGGTC
GACGCGGGCGGCCGGGCCTCCGCGCTGCGCCGCTGGCTGCCCGAACTGGGCCTGGACCAG
GTGGAGGAGGACGTCGTCGACTCCGGGATCGCCTATGCCACCCGGGTGTTCAAGGCCCCG
GCGCCGGTCGCCCAGGGCTTCCCGATGGTCAACATCGCCGCCGCACCCGGACTCGGCAAG
CCCGGCCAGAACGGCGCCCTGGTGCCGATCGAGGACGGCAAGTGGCTGGTCACCCTCGCC
GGTACCCGCGGCGGCGAGCCGCCCACGGACGACGACTCCTTCCTGGACTTCGCCCGCGGC
CTCCGGCACCCCGTCCTCGCCGACCTCCTGGAGCGCGCCGAGCCGCTCGGCCCGGTCAAG
GGCTCCCGCTCCACGGTCAACCGCCGCCTCTACTACGACCGGGTGGCGAACTGGCCCGAC
GGGCTGCTCGTCCTCGGCGACGCCCTCGCGGCCTTCAACCCGGTCTACGGACACGGCATG
AGCTGCTCCGCGCTGAGCGCCAAGGCCCTGGACGCCGAACTCGGCCGCAGCGGACTGGCC
CCCGGCATGGTCCAGGCCGTGCTGCAGAAGGTCGCCAAGGTCGTCGACGATCCCTGGCTG
CTCGCCACCACCCAGGACATCTGCTACCCGGGCACCAAGGTCACCGCCCAGGACCCGCGG
ATCGCCCCGCGCGGCGACCAGGAGCAGCAGTTCGCCGACCTGCTCAGCACCGCCGCCCTG
CACGACCCGGTGGTCAGCGCCGCCGCGATGCAGGTGACCGCGCTCGCCGCGCCCGTCAGC
AGCCTGGAGTCCCCGCACCTGGTGGCCGCCCTGCGCAAGGGCAAGGCCCACGAGCCGCTG
ACCGCACCGCCGTTCAAGGACGCCGAACTGGCCGTACTGGACGGCGACGCCGCGGGCGCG
GCGGCCTCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [15-350]  1.2e-09 PF01494
PF01494   FAD_binding_3
SignalP
 [1-35]  0.538 Signal
Eukaryota   
 [1-35]  0.262 Signal
Bacteria, Gram-negative   
TMHMM No significant hit