close all open/close all

CDS information : Salino3_00330


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction105,116 / 105,877 / + [in whole cluster]
105,116 / 105,877 / + [in contig]
Location105116..105877 [in whole cluster]
105116..105877 [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)putative thioesterase
Gene
Gene (GenBank)slnDII
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • SlnDII
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)
ACC
Q846W2
NITE
Monen_00290
PmId
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)
ACC
H1ZZV3
NITE
Salino_01110
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)

close this sectionSequence

selected fasta
>putative type II thioesterase [putative thioesterase]
MVRHPWDVQAPDAPVRLFCLPWAGGSAVFYQRAWQREFAPDVDVRPLELPGRGIESDEKL
LRRVDDLVDFLLDRLTPLLDRPYALFGHSMGALLSLELTRRLAAEGYPAPVRLFQSGSGI
PGRRHRTTGRALHTLPENEFREWLRTTGGTPAAVFQNPELLDHLSPLLRADFELCDVYRE
RGGAPLSCPVTAIGGDADPYVPVEALSEWSEITTGPCELMVLSGGHFAFQDHLDRVRSYV
AAALRTATAGLTH
selected fasta
>putative type II thioesterase [putative thioesterase]
ATGGTCCGTCACCCCTGGGACGTTCAGGCGCCGGACGCACCCGTGCGGCTGTTCTGCCTT
CCGTGGGCCGGAGGCAGCGCCGTCTTCTACCAGCGGGCCTGGCAGAGAGAGTTCGCACCG
GACGTCGATGTGCGGCCCCTCGAACTCCCGGGCCGCGGCATCGAGTCGGACGAGAAGCTG
CTGCGCCGGGTCGACGACCTGGTCGACTTCCTCCTCGACCGCCTCACCCCGCTCCTGGAC
CGCCCCTACGCCCTCTTCGGCCACAGCATGGGCGCCCTGCTCAGCCTGGAACTCACCCGG
CGCCTGGCCGCCGAGGGCTACCCCGCGCCGGTCCGCCTCTTCCAGTCCGGCAGCGGCATC
CCCGGACGGCGGCACCGCACCACCGGCCGCGCCCTGCACACGCTGCCCGAGAACGAGTTC
CGGGAGTGGCTGCGCACCACCGGCGGGACGCCCGCGGCCGTCTTCCAGAACCCCGAACTC
CTCGACCACCTCTCGCCGTTGCTCCGCGCCGACTTCGAACTCTGCGATGTCTACCGGGAG
CGCGGCGGTGCCCCGCTGTCCTGCCCGGTGACCGCGATCGGCGGCGACGCCGACCCGTAC
GTCCCCGTCGAGGCGCTCTCCGAATGGAGCGAGATCACCACCGGGCCCTGCGAGTTGATG
GTGCTCTCCGGCGGCCACTTCGCCTTCCAGGACCACCTGGACCGCGTGCGGTCCTATGTC
GCCGCGGCGCTGCGGACCGCGACGGCCGGACTCACCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [16-241]  3.5e-41 PF00975
PF00975   Thioesterase
SignalP
 [1-27]  0.222 Signal
Eukaryota   
TMHMM No significant hit