close all open/close all

CDS information : Salino3_00340


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction106,029 / 108,617 / + [in whole cluster]
106,029 / 108,617 / + [in contig]
Location106029..108617 [in whole cluster]
106029..108617 [in contig]
TypeCDS
Length2,589 bp (862 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)putative peptide synthetase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • Orf13
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
H1ZZV4
NITE
Salino_01120
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [putative peptide synthetase]
MIPLSHAQNRLWPADRLGTGHEACHLPLVLRHSGPLDVRALRLALTDLVARHEILRTVFP
ERAGVPYQQILTEAPLPLPVEESGEERLTEDLRRVSAEPFDLRTGIPLRAHLFSLPGGSH
VLLVVLHRIAADEDSLSLLLTGLREAYAARREGAPPSWKPLPVQYADFALWQREVLGDLR
DPDSLLSRQLGEWSTALAGLPQRLTLPADRPGPARWESPAGCVRFKVGAALHRDLLDLGR
GSRATLFMVLHAALAALLTSLGAGEDIPVGSPVTGRADEVLEGVVGCFTNTLVIRSDTAD
KPSFRELLARVRERVLFAYAHGDVPFDLLAEEIAPASAAARAPLVQVLLSLRTERAQEPA
GEPEFTREEPARRTAPAELDLAFTQRRAGDGTPQGMTAVLTYAADRFDHPTAQSLAGELH
TLLRTAVREPLPPPGTEELLGPEQRGPFATAEAEQPGSRMRRSRRERLGHRREEVAAAPG
EGPGEDLCAAAAARARPPATPLESSLCRILAEVLAVEEVEPEDDFFELGGDSLLGMRVLS
RVRARLGIELGVCALFDARPPPVSPRPSPAPSRTPPTTTSEATSRPDGSRAGRAPAPEVP
PRTSAAPRTDRGAARSLGDVRGGAPVQDEEFTAALPHGLAARLEVVVAVAAEELEPAAGV
GDEVLPLVQRVVLGRATAEDHIGLLLGLRHVRALPCADRGRNLPVRPGTAVDRDPLRGRA
PGSGGLRAGPRAPLLPRCSRVRSPRIRGPTAVKGPRVLTRTAPRPSGPPRADMAPMKPWP
AKVRPASHFRTADTGERGGPAARKLSRSVAQWFRVPSPRGSVSQRWVQSGHWRKTLGPLL
LSRYCQCRVQLRPAPQVPQSAP
selected fasta
>non-ribosomal peptide synthetase [putative peptide synthetase]
GTGATCCCGCTGTCCCATGCCCAGAACCGGCTGTGGCCGGCTGACCGGCTGGGCACCGGC
CACGAGGCCTGCCATCTGCCGCTGGTGCTGCGGCACTCCGGCCCGCTCGACGTGCGCGCC
CTGCGCCTCGCGCTGACCGACCTCGTCGCCCGGCACGAGATCCTCCGCACCGTCTTCCCC
GAACGCGCCGGGGTGCCCTACCAGCAGATCCTCACCGAGGCCCCGCTCCCGCTGCCGGTC
GAGGAGAGCGGCGAGGAGCGGCTGACCGAGGACCTGCGGCGGGTGAGCGCCGAACCCTTC
GACCTGCGGACCGGCATCCCGCTGCGGGCCCACCTGTTCAGCCTCCCCGGCGGCAGCCAC
GTACTCCTGGTGGTGCTGCACCGCATCGCCGCCGACGAGGACTCCCTCTCCCTGCTGCTC
ACCGGGCTCCGCGAGGCGTACGCGGCCCGCCGCGAGGGCGCGCCGCCGTCCTGGAAGCCG
CTGCCGGTGCAGTACGCCGACTTCGCGCTGTGGCAGCGCGAGGTCCTCGGCGATCTGCGC
GACCCGGACAGCCTGCTCAGCCGTCAGCTCGGCGAGTGGAGCACGGCCCTCGCCGGGCTG
CCGCAGCGGCTCACCCTGCCCGCGGACCGGCCGGGGCCCGCCCGGTGGGAGAGCCCGGCG
GGCTGCGTGCGCTTCAAGGTCGGGGCCGCCCTGCACCGGGACCTCCTCGACCTGGGGCGC
GGCAGCCGGGCCACCCTCTTCATGGTGCTGCACGCAGCCCTGGCCGCCCTGCTGACCTCA
CTCGGCGCGGGCGAGGACATCCCGGTCGGCTCCCCCGTGACGGGCCGCGCCGACGAGGTC
CTCGAAGGGGTCGTCGGCTGCTTCACCAACACCCTGGTGATCCGCTCCGACACCGCCGAC
AAGCCGTCCTTCCGCGAACTGCTCGCCCGGGTCCGCGAACGCGTCCTGTTCGCCTACGCC
CACGGCGACGTCCCCTTCGACCTGCTCGCCGAGGAGATCGCCCCGGCCTCGGCCGCCGCC
CGCGCCCCGCTCGTCCAGGTCCTGCTGTCGCTGCGCACCGAACGCGCCCAGGAGCCCGCC
GGGGAACCGGAGTTCACCCGCGAGGAGCCCGCCCGCCGCACCGCCCCGGCCGAACTGGAC
CTCGCCTTCACCCAGCGCCGCGCCGGGGACGGCACCCCGCAGGGCATGACCGCGGTGCTC
ACCTACGCCGCCGACCGCTTCGACCACCCGACCGCCCAGTCCCTCGCGGGCGAGCTGCAC
ACCCTGCTGCGCACCGCCGTACGCGAGCCGCTCCCGCCGCCCGGCACCGAGGAGCTCCTC
GGCCCCGAGCAGCGCGGTCCCTTCGCCACCGCCGAGGCGGAGCAGCCCGGTTCACGGATG
CGCCGCAGCAGACGCGAGCGCCTCGGCCACCGCCGGGAGGAGGTCGCCGCGGCACCGGGG
GAGGGGCCCGGCGAGGACCTCTGCGCCGCGGCGGCGGCCCGGGCCAGGCCCCCGGCGACC
CCGCTGGAGTCGAGCCTGTGCCGGATCCTCGCCGAGGTGCTCGCCGTGGAGGAGGTGGAA
CCCGAGGACGACTTCTTCGAGCTGGGCGGGGACTCCCTGCTCGGCATGCGCGTCCTCAGC
CGGGTCCGCGCCCGGCTCGGCATCGAACTGGGCGTCTGCGCCCTCTTCGACGCCCGACCG
CCGCCGGTCTCGCCGAGGCCTTCACCCGCGCCGAGCAGGACGCCGCCGACGACGACGAGC
GAGGCGACGAGCCGCCCGGACGGCAGCCGTGCGGGGAGGGCCCCCGCGCCTGAGGTCCCT
CCCCGCACGTCGGCGGCGCCGCGGACGGACCGCGGCGCCGCCCGCTCACTCGGCGACGTA
CGTGGTGGCGCTCCAGTCCAGGACGAGGAGTTCACGGCCGCCCTGCCGCACGGTCTCGCC
GCTCGCCTCGAAGTGGTCGTAGCGGTTGCCGCGGAGGAGCTTGAACCTGCTGCCGGGGTC
GGCGACGAAGTGCTCCCGCTCGTGCAGCGGGTAGTTCTCGGCCGGGCCACCGCGGAGGAT
CACATTGGTCTGCTGCTCGGACTGCGTCATGTGCGGGCGCTCCCTTGTGCGGATCGGGGT
CGGAACCTGCCGGTCCGCCCCGGCACCGCGGTGGACCGCGACCCGCTCCGGGGCCGCGCG
CCCGGCTCCGGTGGCCTGCGCGCCGGCCCGCGCGCACCTCTGTTGCCGCGGTGCTCGCGA
GTCCGGTCCCCTCGGATCCGGGGCCCGACGGCCGTGAAGGGTCCGCGCGTGCTCACGCGG
ACCGCGCCCCGGCCGTCCGGCCCGCCCCGGGCGGACATGGCACCGATGAAGCCATGGCCC
GCTAAAGTGCGGCCTGCGTCACACTTCCGTACGGCGGACACCGGTGAGCGGGGAGGTCCC
GCGGCTCGGAAGCTCAGTCGCTCAGTCGCTCAGTGGTTCCGGGTGCCGTCTCCGCGCGGG
TCGGTGTCCCAGAGGTGGGTGCAGTCGGGGCACTGGAGGAAGACCCTCGGGCCCTTGTTG
CTCAGCAGGTACTGCCAGTGCCGGGTGCAGCTGCGGCCCGCGCCGCAGGTACCGCAGTCC
GCGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001242 Condensation domain (Domain)
 [1-297]  6.49999999999992e-50 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [527-542]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [495-559]  1.39999892049878e-14 SSF47336
SSF47336   ACP_like
 [492-558]  3.5e-21 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [502-557]  PS50075
PS50075   ACP_DOMAIN
 [506-556]  9.30000000000002e-11 PF00550
PF00550   PP-binding
SignalP No significant hit
TMHMM No significant hit