close all open/close all

CDS information : Salino3_00350


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction108,927 / 108,679 / - [in whole cluster]
108,927 / 108,679 / - [in contig]
Locationcomplement(108679..108927) [in whole cluster]
complement(108679..108927) [in contig]
TypeCDS
Length249 bp (82 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • Orf14
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
H1ZZV7
NITE
Salino_01150
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MFPVVKVVPVSEFAFGVDLTEGEMRRRAAVVEALGSDWDPVAVLEGERAAHDLLYSGLDA
EQQKTYELLVAAGVLEDRQARP
selected fasta
>hypothetical protein [hypothetical protein]
GTGTTCCCGGTAGTGAAGGTGGTCCCCGTGAGCGAGTTCGCGTTCGGCGTCGACCTGACG
GAGGGCGAGATGCGGCGCCGTGCCGCGGTCGTCGAGGCGCTCGGCTCCGACTGGGACCCG
GTGGCCGTACTGGAGGGCGAGCGCGCCGCCCACGATCTGCTCTACTCCGGTCTCGACGCG
GAGCAGCAGAAGACCTACGAGCTGCTCGTGGCCGCGGGTGTCCTGGAGGACCGGCAGGCC
CGGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit