close all open/close all

CDS information : Salino3_00360


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction111,671 / 109,104 / - [in whole cluster]
111,671 / 109,104 / - [in contig]
Locationcomplement(109104..111671) [in whole cluster]
complement(109104..111671) [in contig]
TypeCDS
Length2,568 bp (855 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative SARP family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • Orf15
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
Q2MGB3
NITE
Fred_00260
PmId
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)
ACC
Q54494
NITE
Nogl_00360
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
[9349712] Characterization of Streptomyces nogalater genes encoding enzymes involved in glycosylation steps in nogalamycin biosynthesis. (Mol Gen Genet. , 1997)
ACC
P25941
PmId
[2253887] Primary structure of AfsR, a global regulatory protein for secondary metabolite formation in Streptomyces coelicolor A3(2). (Gene. , 1990)
[11952895] afsS is a target of AfsR, a transcriptional factor with ATPase activity that globally controls secondary metabolism in Streptomyces coelicolor A3(2). (Mol Microbiol. , 2002)
[17434533] AfsR recruits RNA polymerase to the afsS promoter: a model for transcriptional activation by SARPs. (J Mol Biol. , 2007)
ACC
H1ZZV8
NITE
Salino_01160
PmId
[22076845] A late-stage intermediate in salinomycin biosynthesis is revealed by specific mutation in the biosynthetic gene cluster. (Chembiochem. , 2012)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative SARP family transcriptional regulator]
MRFQVLGPLAVRAAEPGRSTLTPRAAKLRVVLATLLVRRGEIVSVAGLIDELWGDRPPRT
AKTTLQVYVSQLRKRLFGGAPGTGTLETRMPGYLLQVDPEQLDLSAFESLHARGREAMED
RDWDRAADRQRRALALWRGPLLSDTPHGALLGTAATRLAELRTSALEQRIRAELHQGRHH
DLVGELQGLTAEFPLREEFHAHLMVALYRTGRQAEALRAFAALRRTLVEELAIEPGRALQ
ELHRRILAADETLLGPPEAPVVLTEAPQTAPGTAPVRLPDRVADELPPPEPLFTGRTAAL
DALGAELAAGAGGCVLVTGGPGTGKTALALAAAHAAGFPDGRVLVECGAEGAPRDEAPLL
TEVLRRCGATGTLPEHGAELAALLRTLTAGRRLLFVLDGADRAELILPVCAAAPGSVVLA
TSRRSPAGVEGRTLRLGELDPAEARELLLAARRAQQGPEASGGAPDPAVLDRIVRRCGAL
PGALRAAAGLLPLHPHWDADRLAERLRAEDTRLGLLRRGSARFARSLESAYGTAADPAGF
RLLGLLPPGPFTVPAAAALFGSGPGAAEDRLGALLAEGLLTTVPAAAPGGARFRLPEALR
LLALERLRAEDEAPVLRAATGRLCDHLSARLAAAYRGGGPERAAHPDLVRLLERAHDLGL
WAPVVRLAEALTPSFEEQADWGPWREGHTRALDAARRAGDRRAEARLRRSLGDLAWQRRG
HTAARAHYAAALALARGVPDAEETGRCLAGLAELSLDAGGFTEAARLLDLALAASGDGGR
GRYEARRVGALLALDRGRPEAAERHFAECLRLAAALGEPRLEAYARRCLAGVRDAPGSPG
GLELRPGVWRLRPAH
selected fasta
>putative transcriptional regulator [putative SARP family transcriptional regulator]
ATGCGGTTCCAGGTACTGGGTCCCCTGGCGGTGCGGGCCGCCGAGCCGGGGCGGAGCACC
CTCACCCCGCGCGCCGCCAAGCTCCGCGTGGTGCTCGCCACGCTCCTGGTGCGCCGCGGC
GAGATCGTCTCGGTGGCCGGACTGATCGACGAGCTGTGGGGCGACAGGCCGCCGCGCACC
GCGAAGACGACCCTCCAGGTGTACGTCTCCCAGCTGCGCAAGCGGCTCTTCGGCGGCGCC
CCCGGCACCGGGACGCTGGAGACGCGGATGCCCGGCTACCTCCTCCAGGTGGACCCGGAG
CAGCTGGACCTGAGCGCCTTCGAGTCCCTGCACGCGCGCGGGCGCGAGGCGATGGAGGAC
CGGGACTGGGACCGGGCGGCGGACCGGCAGCGCCGCGCCCTGGCGCTCTGGCGCGGCCCG
CTGCTCTCGGACACCCCGCACGGCGCCCTGCTTGGCACCGCCGCGACCCGGCTCGCCGAG
CTGCGGACCAGCGCCCTGGAGCAGCGGATACGCGCCGAGCTGCACCAGGGCCGCCACCAC
GACCTGGTCGGTGAACTCCAGGGCCTGACCGCGGAGTTCCCGCTGCGCGAGGAGTTCCAC
GCGCATCTGATGGTGGCGCTCTACCGCACCGGGCGGCAGGCCGAGGCGCTGCGCGCCTTC
GCCGCCCTGCGCCGCACCCTGGTCGAGGAGCTGGCGATCGAGCCGGGCCGCGCGCTCCAG
GAGCTGCACCGCCGGATCCTCGCCGCCGACGAGACCCTGCTCGGCCCGCCGGAGGCACCG
GTGGTGCTCACGGAGGCGCCGCAGACCGCGCCGGGGACGGCACCGGTGCGCCTCCCGGAC
CGGGTGGCGGACGAACTCCCGCCGCCGGAACCGCTGTTCACCGGACGGACCGCCGCCCTG
GACGCCCTCGGCGCGGAGCTGGCCGCGGGCGCGGGCGGCTGCGTCCTGGTGACCGGAGGG
CCCGGGACCGGCAAGACGGCACTGGCGCTCGCGGCGGCCCACGCGGCGGGCTTCCCGGAC
GGCCGGGTCCTGGTGGAGTGCGGGGCCGAGGGGGCGCCCCGCGACGAGGCCCCCCTGCTC
ACAGAGGTGCTGCGCCGCTGCGGGGCCACCGGCACGCTGCCGGAGCACGGCGCCGAGCTG
GCCGCACTGCTGCGGACGCTCACCGCCGGGCGGCGGCTGCTCTTCGTCCTGGACGGGGCC
GACCGGGCGGAGCTGATCCTGCCCGTGTGCGCGGCCGCCCCCGGCAGCGTGGTCCTCGCG
ACCTCCCGCCGGAGCCCGGCGGGCGTCGAGGGCCGGACCCTCCGGCTCGGCGAGCTGGAC
CCGGCCGAGGCGCGGGAGCTGCTGCTCGCCGCCCGCAGGGCGCAGCAGGGGCCGGAGGCC
TCCGGCGGCGCCCCGGATCCGGCCGTCCTGGACCGGATCGTGCGCCGGTGCGGGGCGCTG
CCGGGCGCGCTGCGCGCCGCGGCCGGGCTGCTCCCGCTCCACCCGCACTGGGACGCCGAC
CGCCTCGCCGAGCGGCTGCGCGCGGAGGACACCCGGCTCGGGCTGCTGCGCCGCGGCAGC
GCCCGCTTTGCCCGGTCCCTGGAGTCCGCGTACGGGACCGCCGCGGACCCGGCGGGCTTC
CGGCTGCTCGGGCTGCTGCCGCCGGGGCCCTTCACGGTGCCCGCCGCCGCGGCGCTCTTC
GGCAGCGGACCGGGGGCCGCGGAGGACCGCCTCGGCGCGCTGCTCGCCGAGGGCCTGCTC
ACCACCGTGCCCGCCGCCGCACCGGGCGGGGCCCGCTTCCGGCTGCCCGAGGCGCTGCGG
CTGCTCGCCCTGGAGCGGCTGCGCGCGGAGGACGAGGCACCGGTGCTGCGGGCCGCGACC
GGTCGGCTCTGCGACCACCTGTCCGCCCGGCTGGCGGCGGCGTACCGCGGCGGCGGCCCG
GAGCGCGCCGCGCACCCGGATCTCGTACGGCTCCTGGAGCGGGCCCATGACCTGGGGCTG
TGGGCCCCGGTGGTGCGGCTCGCCGAGGCGCTCACCCCCTCCTTCGAGGAGCAGGCCGAC
TGGGGGCCCTGGCGGGAGGGCCACACCCGCGCCCTGGACGCGGCCCGGCGCGCGGGCGAC
CGCCGGGCCGAGGCGCGCCTGCGCCGCTCGCTGGGCGACCTGGCCTGGCAGCGGCGGGGG
CACACCGCAGCCCGCGCGCACTACGCGGCCGCCCTCGCGCTGGCGCGCGGGGTCCCGGAC
GCCGAGGAGACCGGCCGCTGCCTCGCCGGGCTCGCCGAACTCAGCCTGGACGCGGGCGGG
TTCACCGAGGCGGCCCGGCTGCTCGACCTCGCGCTCGCGGCGAGCGGGGACGGCGGGCGC
GGCCGGTACGAGGCCCGGCGGGTGGGCGCGCTGCTGGCCCTGGACCGCGGGCGGCCCGAG
GCGGCCGAGCGGCATTTCGCGGAGTGCCTGCGGCTGGCCGCGGCGCTCGGCGAGCCCCGC
CTGGAGGCCTACGCCCGGCGCTGCCTGGCCGGGGTGCGCGACGCCCCCGGGAGCCCGGGC
GGACTCGAACTGCGGCCCGGCGTCTGGCGGTTGCGCCCGGCCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [17-95]  6.59999852526375e-10 SM00862
SM00862   Trans_reg_C
 [23-95]  6.3e-12 PF00486
PF00486   Trans_reg_C
IPR003593 AAA+ ATPase domain (Domain)
 [311-455]  1.49999977583352e-07 SM00382
SM00382   AAA
IPR005158 Bacterial transcriptional activator domain (Domain)
 [102-247]  1.29999999999998e-46 PF03704
PF03704   BTAD
 [102-247]  3.10001307370206e-53 SM01043
SM01043   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [108-223]  2.9e-08 G3DSA:1.25.40.10 [676-814]  3.60000000000001e-11 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [21-98]  6e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-96]  1.69999922284049e-12 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit