close all open/close all

CDS information : Salino3_00370


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction111,987 / 113,780 / + [in whole cluster]
111,987 / 113,780 / + [in contig]
Location111987..113780 [in whole cluster]
111987..113780 [in contig]
TypeCDS
Length1,794 bp (597 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative carboxylic acid--ACP ligase
putative acyl-ACP synthetase
Product (GenBank)putative AMP-binding domain-containing protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • Orf16
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
D2IKP9
PmId
[20081823] In vitro reconstruction of tetronate RK-682 biosynthesis. (Nat Chem Biol. , 2010)
ACC
Q50E76
PmId
[18959760] Role of DptE and DptF in the lipidation reaction of daptomycin. (FEBS J. , 2008)

close this sectionSequence

selected fasta
>putative carboxylic acid--ACP ligase [putative AMP-binding domain-containing protein]
MLRERAAAHPGREALVFLPASGGAPERLDYGTLDAAARSLAHRLCALGAPGRPVLLAHPP
GPNFLKALAGCFYAGAVPVPVPLPGPRGERLHRLTGVLRDSGARLVLTDEEHAPDLSLRL
AMAGLGDTVCLAADRPEATAPGGEEPPARSGGDLALVQYTSGSTTRPRGVLLSHRNLLAQ
QSTLQGMLRSTPADRLGGWLPHFHDLGLIAHLLHALWLGTRCVQLPPATFRKSPVRWLEA
IGEHGITIGGAPHFAYERCVEAVTEEQAAGLDLSGWRLALDGGEPVRPAGLAAFTRRFAP
AGFRAEALCPGYGLAEAALAVSCGRPGLPYAVRDFDAARLTAGELRPAAPGAASRALVGL
GRPAGCELRIVDPADGSELAPGRVGEIWVRGEGVARGYWNRSPGGTDTPDGAETFDATLD
SGEGGYLRTGDLGALEAGQLYVTGRLKDLLFLEGRTIHPADIEAAPRELSPALGTGVGAA
FTVEADRPRLVLVQEIRADRTDPGRLPALAARIRLLIAEEFEVPAENILLVAPGTVSRTT
DGTVHRARTRTRFLTGETESLYETLTPDVRALVRPEHTALGHDLLQRPVPAEADLAW
selected fasta
>putative carboxylic acid--ACP ligase [putative AMP-binding domain-containing protein]
GTGCTGCGCGAGCGGGCCGCCGCACATCCGGGCCGCGAGGCCCTGGTCTTCCTGCCCGCC
TCCGGCGGCGCCCCCGAACGCCTCGACTACGGGACGCTCGACGCCGCCGCCCGGAGCCTC
GCCCACCGCCTGTGCGCCCTCGGCGCCCCCGGTCGCCCCGTCCTCCTCGCCCACCCGCCG
GGCCCCAACTTCCTGAAGGCGCTGGCCGGTTGCTTCTACGCGGGTGCCGTACCCGTACCC
GTACCGCTGCCGGGACCGCGCGGCGAACGCCTGCACCGGCTCACGGGTGTGCTGCGCGAC
AGCGGCGCCCGCCTCGTCCTCACCGACGAGGAGCACGCCCCCGACCTCTCGCTCCGGCTG
GCGATGGCGGGCCTCGGCGACACGGTCTGCCTGGCCGCGGACCGGCCGGAGGCGACCGCC
CCCGGCGGCGAGGAGCCCCCCGCGCGGTCCGGCGGCGACCTCGCCCTGGTGCAGTACACC
TCCGGCTCCACCACCCGCCCGCGCGGCGTCCTGCTCAGCCACCGCAACCTCCTCGCCCAG
CAGTCCACCCTGCAGGGCATGCTCCGCTCCACCCCCGCGGACCGGCTCGGCGGCTGGCTG
CCGCACTTCCACGACCTGGGCCTGATCGCGCACCTGCTGCACGCCCTGTGGCTGGGCACC
CGGTGCGTCCAACTCCCCCCGGCGACCTTCCGGAAGAGCCCGGTGCGCTGGCTGGAGGCG
ATCGGCGAGCACGGCATCACCATCGGCGGCGCGCCCCACTTCGCCTACGAGCGGTGCGTC
GAGGCGGTCACCGAGGAGCAGGCCGCGGGACTCGACCTCTCCGGCTGGCGGCTGGCCCTC
GACGGCGGGGAACCGGTGCGCCCCGCGGGGCTCGCCGCCTTCACCCGCCGCTTCGCGCCC
GCCGGATTCCGCGCCGAGGCCCTCTGCCCCGGCTACGGACTCGCCGAGGCCGCCCTCGCC
GTGAGCTGCGGTCGGCCCGGACTCCCTTATGCCGTACGGGACTTCGACGCCGCCCGCCTC
ACCGCGGGCGAACTGCGGCCCGCCGCGCCCGGCGCCGCGAGCCGCGCCCTGGTCGGCCTG
GGCCGCCCCGCGGGCTGCGAGCTGCGGATCGTGGACCCGGCCGACGGCAGCGAACTGGCC
CCCGGCCGGGTCGGGGAGATCTGGGTCCGCGGCGAGGGCGTCGCCCGCGGCTACTGGAAC
CGCTCCCCAGGCGGCACGGACACCCCGGACGGCGCGGAGACCTTCGACGCCACCCTCGAC
AGCGGCGAGGGCGGCTATCTGCGCACCGGCGACCTCGGCGCCCTGGAGGCCGGGCAGCTC
TACGTCACCGGCCGCCTGAAGGACCTCCTCTTCCTGGAGGGGCGCACGATCCACCCGGCC
GACATCGAGGCGGCCCCGCGCGAGCTGAGCCCCGCCCTCGGCACCGGAGTCGGCGCCGCC
TTCACCGTGGAGGCGGACCGCCCCCGCCTCGTCCTCGTCCAGGAGATCCGCGCCGATCGC
ACCGACCCGGGCCGCCTGCCCGCCCTCGCCGCCCGGATCCGCCTGCTGATCGCCGAGGAG
TTCGAGGTGCCCGCCGAGAACATCCTCCTCGTCGCCCCCGGCACCGTCTCCCGCACCACC
GACGGCACGGTGCACCGCGCCCGCACCCGCACCCGCTTCCTCACGGGCGAAACGGAGAGC
CTGTACGAGACGCTCACCCCCGATGTCCGCGCCCTGGTCCGCCCCGAGCACACCGCGCTC
GGGCACGACCTGCTCCAGCGCCCGGTGCCCGCCGAAGCGGACCTCGCGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [30-466]  5.09999999999992e-76 PF00501
PF00501   AMP-binding
SignalP No significant hit
TMHMM No significant hit