close all open/close all

CDS information : Salino3_00380


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction113,774 / 115,492 / + [in whole cluster]
113,774 / 115,492 / + [in contig]
Location113774..115492 [in whole cluster]
113774..115492 [in contig]
TypeCDS
Length1,719 bp (572 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl-CoA dehydrogenase
Product (GenBank)putative acyl-CoA dehydrogenase
Gene
Gene (GenBank)
EC number1.3.99.-
Keyword
Note
Note (GenBank)
  • Orf17
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
Q4H1D1
PmId
[15942003] An acyl-CoA dehydrogenase is involved in the formation of the Delta cis3 double bond in the acyl residue of the lipopeptide antibiotic friulimicin in Actinoplanes friuliensis. (Microbiology. , 2005)

close this sectionSequence

selected fasta
>putative acyl-CoA dehydrogenase [putative acyl-CoA dehydrogenase]
MVSTRAGAPGTGVARRPEPPPVRAARLEDLLGDPAAHRPAGHRALLAADRRGRPPAEAEA
LLDDFGMGAELVPRALGGHFDSAEGLLRILRPAARRDLALGAGALDSFAAASPVWAAGRP
DQRAALAALLRSGERAALAAPAGLADHTLQVRGPGLHGAASGIAQLPRARALVVFPRREP
ERTGHTALLLDPAALPPDRARLRPRPPGPGLRHIPYGDLEFTDCPVPGGSLLGDPGDGMP
LALRSLRTARTLTAALCVGAADTALRTAALTGRPDHDSRGPQAGSERRDPRRTAAVLSAA
FADLLLCDSLALAATRALHLRPAESALCSTAAASLLPRLLRGTLQDLSTLLGARILGEEG
GAGILAKHLRDLPALGAAARCRAALIPQLPLLARESWSREPEPSGELFHPGGPLPPFAHA
PLTTAARRDVLGAALLATAEQPFPDDPAGRALATLTRQLRADLLDLRDTARALPAPRPGH
AAAPAWFSLADRCVLLLAAGAVLGVWRHRRAAGDPFLADPAWAATALHRLAVRLGAPAVD
LPASCTARLHAEVLARCARRESLDLYRTALAG
selected fasta
>putative acyl-CoA dehydrogenase [putative acyl-CoA dehydrogenase]
GTGGTGAGCACCCGCGCCGGTGCCCCGGGCACCGGCGTCGCCCGCCGCCCCGAGCCGCCC
CCGGTGCGCGCCGCCCGCCTGGAGGACCTGCTCGGCGACCCGGCCGCGCACCGGCCCGCC
GGTCACCGGGCGCTGCTCGCCGCCGACCGCCGGGGGCGGCCGCCGGCGGAGGCCGAGGCC
CTGCTCGACGACTTCGGGATGGGCGCGGAACTCGTCCCCCGCGCGCTCGGCGGCCACTTC
GACTCCGCCGAGGGACTGCTGCGGATACTGCGCCCGGCGGCCCGGCGCGATCTCGCCCTG
GGCGCCGGGGCCTTGGACTCCTTCGCGGCGGCCTCGCCGGTGTGGGCGGCCGGGCGTCCG
GACCAACGCGCGGCCCTGGCCGCCCTGTTGCGCTCCGGGGAGCGCGCCGCCCTCGCGGCC
CCGGCCGGACTCGCGGACCACACCCTCCAGGTACGCGGGCCCGGCCTGCACGGCGCGGCC
TCCGGGATCGCCCAACTCCCGCGCGCCCGGGCGCTGGTGGTCTTCCCCCGCCGGGAACCG
GAGCGCACCGGCCACACCGCCCTGCTGCTCGACCCGGCCGCCCTGCCCCCGGACCGCGCC
CGCCTGCGCCCCCGCCCACCCGGGCCCGGACTGCGCCACATCCCGTACGGGGACCTGGAG
TTCACCGACTGCCCGGTACCCGGCGGGAGCCTGCTCGGTGACCCCGGGGACGGGATGCCG
CTCGCCCTGCGCTCGCTGCGCACCGCCCGGACCCTGACCGCGGCCCTGTGCGTAGGCGCC
GCCGACACCGCCCTGCGCACCGCCGCCCTCACCGGGCGCCCGGACCACGACTCCCGTGGC
CCGCAAGCCGGTTCGGAACGGCGCGACCCCCGGCGCACCGCCGCCGTCCTCAGCGCCGCC
TTCGCCGATCTGCTGCTCTGCGACAGCCTCGCCCTCGCCGCCACCCGCGCCCTGCACCTG
CGCCCCGCGGAATCCGCGCTCTGCTCGACGGCCGCGGCGAGCCTCCTGCCCCGGCTGCTC
CGCGGGACCCTCCAGGACCTCTCCACCCTGCTCGGCGCCCGGATCCTCGGCGAGGAGGGC
GGCGCGGGCATCCTCGCCAAGCACCTGCGCGACCTGCCCGCCCTCGGCGCCGCCGCGCGC
TGCCGTGCCGCACTCATCCCCCAACTGCCGCTGCTCGCCCGGGAGTCCTGGTCGCGCGAG
CCGGAGCCCTCCGGCGAACTCTTCCACCCCGGCGGCCCCTTGCCGCCCTTCGCCCACGCG
CCGCTCACCACGGCGGCCCGCCGGGACGTACTGGGCGCCGCCCTCCTCGCCACCGCCGAG
CAGCCCTTCCCGGACGACCCGGCGGGGCGCGCCCTGGCCACCCTGACCCGCCAACTGCGC
GCGGACCTGCTGGACTTGAGGGACACGGCCCGCGCGCTGCCCGCACCCCGCCCCGGTCAC
GCCGCTGCCCCGGCCTGGTTCTCGCTCGCCGACCGCTGTGTGCTGCTGCTCGCCGCCGGG
GCCGTCCTCGGCGTCTGGCGCCACCGGCGTGCCGCGGGCGACCCCTTCCTCGCCGACCCC
GCCTGGGCCGCCACCGCCCTGCACCGACTCGCCGTCCGGCTCGGCGCCCCCGCTGTGGAC
CTGCCCGCCTCCTGCACCGCCCGCCTGCACGCCGAGGTCCTCGCCCGCTGCGCCCGCCGG
GAGAGCCTCGACCTGTACCGCACCGCCCTCGCCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [217-269]  1.1e-08 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [30-237]  8.90000829418053e-15 SSF56645
SSF56645   AcylCoA_dehyd_NM
SignalP No significant hit
TMHMM No significant hit