close all open/close all

CDS information : Salino3_00390


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction115,524 / 115,814 / + [in whole cluster]
115,524 / 115,814 / + [in contig]
Location115524..115814 [in whole cluster]
115524..115814 [in contig]
TypeCDS
Length291 bp (96 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl carrier protein
Product (GenBank)putative peptide carrier protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • Orf18
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
D2IKQ0
PmId
[20081823] In vitro reconstruction of tetronate RK-682 biosynthesis. (Nat Chem Biol. , 2010)
ACC
Q50E75
PmId
[18959760] Role of DptE and DptF in the lipidation reaction of daptomycin. (FEBS J. , 2008)

close this sectionSequence

selected fasta
>putative acyl carrier protein [putative peptide carrier protein]
MTRPAPWYESAALHGWLAHRLSVYLERPPVRIDPTVPLVEYGLDSVGALSLCGDIEDDFG
LAVDPRLARELPTVTALAGYLTAQGAHLDRPEGWPW
selected fasta
>putative acyl carrier protein [putative peptide carrier protein]
ATGACCCGCCCCGCCCCCTGGTACGAGAGCGCCGCCCTGCACGGCTGGCTGGCCCACCGG
CTCTCGGTCTACCTGGAGCGGCCCCCGGTCCGTATCGACCCCACGGTGCCCCTCGTCGAG
TACGGACTCGACTCGGTGGGCGCGCTGAGCCTGTGCGGCGACATCGAGGACGACTTCGGC
CTCGCCGTCGACCCCCGCCTCGCCCGCGAACTCCCCACCGTGACCGCCCTCGCCGGATAT
CTGACCGCACAGGGCGCGCACCTCGACCGGCCCGAGGGGTGGCCGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [9-82]  PS50075
PS50075   ACP_DOMAIN
 [25-81]  4.70000000000001e-12 PF00550
PF00550   PP-binding
 [16-84]  1e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [6-84]  5.20000089003336e-14 SSF47336
SSF47336   ACP_like
SignalP No significant hit
TMHMM No significant hit