close all open/close all

CDS information : Salino3_00400


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction115,811 / 116,650 / + [in whole cluster]
115,811 / 116,650 / + [in contig]
Location115811..116650 [in whole cluster]
115811..116650 [in contig]
TypeCDS
Length840 bp (279 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative phosphopantetheinyl transferase
Product (GenBank)putative 4'-phosphopantetheinyl transferase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • Orf19
Reference
ACC
PmId
[22156425] Cloning and characterization of the polyether salinomycin biosynthesis gene cluster of Streptomyces albus XM211. (Appl Environ Microbiol. , 2012)
Related Reference
ACC
Q9RFL1
NITE
Myxo_00010
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)
[11134965] The mtaA gene of the myxothiazol biosynthetic gene cluster from Stigmatella aurantiaca DW4/3-1 encodes a phosphopantetheinyl transferase that activates polyketide synthases and polypeptide synthetases. (J Biochem. , 2001)
Family/Domain
FD
IPR008278

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase [putative 4'-phosphopantetheinyl transferase]
MSTPAAPGLGRSLAVTPAEGGRDAIREALARHGTALVHGCLPDWETADQDNPAIRALRGR
DRERYLALPGAARARFAASRRLLAHLVAAALDTRPGELELGHDPTGRPRVRGLDEICLSL
SHTGRLLLAGLTTRGLLGVDAEAADRALRSRSLVRQLCTPWELGELALLPEAAGDAGLVR
LWTLKEAYTKAIGQGMQFPFTEFGFGFGDGPLRLLLPDGRPGADTAWSFGSFGLVSGGEA
YRVSAALLDEGRAPSPGLVLDAEVAGAVTAALYGGGPGP
selected fasta
>putative phosphopantetheinyl transferase [putative 4'-phosphopantetheinyl transferase]
GTGAGCACCCCGGCGGCCCCCGGTCTCGGCCGCTCCCTCGCCGTCACCCCGGCCGAGGGC
GGGCGGGACGCCATCCGCGAGGCCCTGGCGCGGCACGGCACCGCGCTGGTGCACGGCTGC
CTCCCCGACTGGGAGACCGCGGACCAGGACAACCCCGCCATCCGTGCGCTGCGGGGCCGG
GACCGGGAGCGCTACCTCGCCCTGCCCGGCGCGGCGCGCGCCCGCTTCGCCGCCTCGCGC
CGCCTGCTCGCCCATCTGGTGGCCGCCGCGCTGGACACCCGGCCCGGGGAGTTGGAGCTC
GGCCACGACCCCACCGGGCGGCCCCGCGTCCGCGGCCTCGACGAGATCTGCCTCAGCCTC
AGCCACACCGGGCGGCTCCTCCTCGCCGGGCTCACCACCCGGGGGCTCCTCGGCGTCGAC
GCCGAGGCCGCCGACCGGGCGCTGCGCTCCCGGAGCCTGGTCAGGCAGCTGTGCACGCCC
TGGGAGCTCGGTGAACTCGCCCTCCTCCCGGAGGCCGCGGGCGATGCCGGACTGGTCCGG
CTGTGGACCCTGAAGGAGGCGTACACCAAGGCGATCGGGCAGGGCATGCAGTTCCCCTTC
ACCGAGTTCGGCTTCGGCTTCGGGGACGGGCCGCTGCGGCTGCTGCTCCCGGACGGCCGC
CCCGGCGCGGACACCGCGTGGTCCTTCGGCAGCTTCGGCCTGGTGAGCGGCGGCGAGGCC
TACCGGGTGAGCGCCGCCCTGCTCGACGAGGGCCGCGCCCCTTCGCCGGGCCTGGTCCTC
GACGCGGAGGTGGCCGGGGCCGTCACCGCCGCGCTGTACGGCGGCGGCCCCGGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [34-141]  2.39999798157265e-15 SSF56214 [135-250]  1.29999924468179e-14 SSF56214
SSF56214   4-PPT_transf
 [137-202]  2.4e-10 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
 [137-210]  1.9e-11 PF01648
PF01648   ACPS
SignalP No significant hit
TMHMM No significant hit