close all open/close all

CDS information : Salino3_00410


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction117,658 / 116,675 / - [in whole cluster]
117,658 / 116,675 / - [in contig]
Locationcomplement(116675..117658) [in whole cluster]
complement(116675..117658) [in contig]
TypeCDS
Length984 bp (327 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative gamma-butyrolactone biosynthesis protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf20

close this sectionSequence

selected fasta
>hypothetical protein [putative gamma-butyrolactone biosynthesis protein]
MSDYATGAAVRALPTRHLIHRPRSTAPGPAEEFVLTGELPRAHPLFNDGPGTWHELAAAA
EMVREAAEFIGPQHFGIAPQRTGLFYRFGIEAGDLGAWRTAAGPGLLTVAMTVTPDKVID
HVPRALEFRAALDIDDRPAGTATAQLIFLAPLLGARHRSTSRREALDGHEIAAYGDPDRA
PADRDPAAPPVEPASVGRLRPDNVLLQDAEFASSGRLSARVLIPPAHPLRPPAGHPVPSA
LLLEAVRQSSLLAAHRTHRLPMAGLLLSSLDAQVRGYAEPELPLRCTAIAGAPHRAADGS
RRAPLTLTLSQQRRTVIEATATVTHLP
selected fasta
>hypothetical protein [putative gamma-butyrolactone biosynthesis protein]
GTGAGCGACTACGCGACCGGTGCGGCGGTCCGCGCCCTACCGACCCGCCACCTCATCCAC
CGGCCGCGGTCCACGGCGCCCGGGCCCGCCGAGGAGTTCGTGCTCACCGGTGAACTCCCG
CGCGCCCACCCGCTGTTCAACGACGGTCCGGGCACCTGGCACGAGCTGGCGGCGGCCGCG
GAGATGGTGCGCGAGGCCGCGGAGTTCATCGGCCCGCAGCACTTCGGGATCGCCCCGCAG
CGCACCGGCCTCTTCTACCGGTTCGGCATCGAGGCGGGCGACCTCGGCGCCTGGCGGACC
GCGGCGGGCCCCGGACTGCTGACGGTCGCCATGACGGTCACCCCCGACAAGGTCATCGAC
CATGTGCCGCGCGCCCTGGAGTTCCGCGCCGCACTCGACATCGACGACCGCCCCGCGGGC
ACGGCCACCGCCCAACTGATCTTCCTGGCGCCCCTGCTCGGCGCGCGGCACCGCAGCACC
AGCCGCCGGGAAGCCCTCGACGGCCACGAGATTGCCGCGTACGGGGATCCGGACCGGGCC
CCGGCGGACCGGGATCCGGCGGCGCCTCCCGTGGAGCCCGCCTCGGTGGGCCGCCTCCGG
CCGGACAACGTCCTGCTCCAGGACGCCGAGTTCGCCTCCAGCGGGCGGCTCTCGGCGCGG
GTCCTGATCCCCCCGGCGCACCCGCTGCGGCCCCCGGCCGGGCATCCGGTCCCCTCCGCC
CTGCTGCTCGAAGCGGTGCGCCAGTCCTCGCTGCTCGCCGCCCACCGCACCCACCGGCTC
CCCATGGCCGGGCTGCTGCTCTCTTCGCTCGACGCGCAGGTACGCGGCTACGCGGAGCCC
GAACTCCCCCTGCGCTGCACGGCGATCGCGGGGGCCCCGCACCGGGCGGCCGACGGCAGC
CGCCGGGCGCCCCTGACGCTGACCCTCAGCCAGCAGCGGCGCACCGTCATCGAGGCCACC
GCCACGGTGACCCACCTGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005509 A-factor biosynthesis hotdog domain (Domain)
 [196-324]  8.49999999999995e-18 PF03756
PF03756   AfsA
SignalP No significant hit
TMHMM No significant hit