close all open/close all

CDS information : Salino3_00420


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction118,878 / 117,832 / - [in whole cluster]
118,878 / 117,832 / - [in contig]
Locationcomplement(117832..118878) [in whole cluster]
complement(117832..118878) [in contig]
TypeCDS
Length1,047 bp (348 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf21

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPATRGSLGRLTGAALLTAAFAAPLAAHASTGEGGTGANAPAAAEDRTLRVYSNNIENLV
RNNSDGSCTRISGPDHLSSLLVDDSGKTGTAGVKAPDLLIVQQIRGRGQADAYADQLSAK
FGLPKGTYKTVLANEDPEEWGGSHHCSSQDLGNLKKKQTNGILYNSQRLNLASGDVADYW
SAGWLKPGTAYADGQGCTLYKPPNADEGATNAHKWRRTSAIAARFTVKTTGTSVFAATMH
LPQENSAHACAGDKDKGIGGTGIHLGADATRLMNASTLRVVGMDANRSGIPADTLSAQGM
TGYGAKPTHGTRKIDYLFVRGTVAPSPVDHTVNSTKSNHLGLYAMLTY
selected fasta
>hypothetical protein [hypothetical protein]
ATGCCCGCCACCCGAGGAAGCCTCGGCCGCCTGACCGGGGCGGCCCTGCTGACGGCCGCC
TTCGCCGCCCCGCTCGCGGCGCACGCCAGCACCGGCGAGGGCGGCACCGGGGCGAACGCC
CCGGCCGCCGCCGAGGACCGGACGCTGCGGGTCTACTCGAACAACATCGAGAACCTGGTG
CGCAACAACTCCGACGGGAGCTGCACCCGGATCTCCGGACCGGACCACCTCTCCTCCCTC
CTCGTCGACGACAGCGGCAAGACCGGCACGGCCGGGGTCAAGGCGCCCGATCTGCTGATC
GTCCAGCAGATCCGCGGGCGCGGTCAGGCCGACGCCTACGCCGACCAGCTCTCCGCCAAG
TTCGGCCTGCCCAAGGGGACGTACAAGACGGTGCTCGCGAACGAGGACCCCGAGGAGTGG
GGCGGTTCGCACCACTGCTCCTCGCAGGACCTCGGGAACCTGAAGAAGAAGCAGACCAAC
GGCATCCTCTACAACTCCCAGCGCCTGAACCTCGCCTCCGGTGACGTGGCGGACTACTGG
AGCGCGGGCTGGCTCAAGCCGGGTACCGCCTACGCCGACGGCCAGGGCTGCACCCTCTAC
AAGCCGCCGAACGCCGACGAGGGCGCGACCAACGCGCACAAGTGGCGGCGCACCAGCGCC
ATCGCGGCCCGGTTCACCGTGAAGACCACCGGTACCAGCGTCTTCGCCGCCACCATGCAC
CTGCCGCAGGAGAACTCCGCGCACGCCTGCGCCGGGGACAAGGACAAGGGCATCGGCGGC
ACCGGCATCCACCTCGGCGCGGACGCCACCCGCCTGATGAACGCCTCCACCCTCCGCGTC
GTCGGCATGGACGCCAACCGCTCCGGCATCCCCGCCGACACCCTCTCCGCCCAGGGCATG
ACCGGCTACGGCGCCAAGCCCACCCACGGCACCCGCAAGATCGACTACCTCTTCGTCCGC
GGCACCGTGGCCCCCTCCCCCGTCGACCACACGGTGAACAGCACCAAGTCCAACCACCTG
GGGCTGTACGCGATGCTCACGTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-29]  0.815 Signal
Bacteria, Gram-negative   
 [1-29]  0.704 Signal
Bacteria, Gram-positive   
 [1-22]  0.696 Signal
Eukaryota   
TMHMM No significant hit