close all open/close all

CDS information : Salino3_00430


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction120,190 / 119,021 / - [in whole cluster]
120,190 / 119,021 / - [in contig]
Locationcomplement(119021..120190) [in whole cluster]
complement(119021..120190) [in contig]
TypeCDS
Length1,170 bp (389 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative secreted protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf22

close this sectionSequence

selected fasta
>[putative secreted protein]
MTGTPHRPLGTGRLSRRTLLAATGAAAAVALTSGPARAARAAATVPLYLGTYTSSGGAQG
IGIAAFDPATGAITGKGSLAGVSDPSFLASAPGHLYAVNEQQGSVTAIAVRDGELSVLGS
SPTGGEGPCHLLVHGEGGHVLSANYTSGSVSVHPLAADGSLREASDLVQHTGSGPDPDRQ
EGPHAHMVLGTPSGRFVLAVDLGTDSVYTYRLDTGTGKLEAVVQNRVTPGLGPRHAAFHP
GGSHLYVANELGDSLSVCSYDDASGEITVLDSLPTVPSGDPAGERNYPAEVLLSPDGAYV
YVSNRGHDSIARFAVGGGGGELTLLDTVPAQGSYPRHISLDPTGRWLFAANQKSGSVGVF
ARDEATGTLKAVGTPFAAPTPVCVLPVAD
selected fasta
>[putative secreted protein]
ATGACAGGCACCCCGCACCGCCCCTTGGGGACGGGCCGTCTCAGCCGCCGGACGCTGCTC
GCCGCGACCGGCGCCGCCGCCGCGGTCGCCCTCACCTCCGGCCCGGCCCGCGCGGCACGC
GCCGCCGCCACCGTGCCGCTCTACCTCGGGACCTACACCTCCTCGGGCGGCGCTCAGGGC
ATAGGCATCGCCGCCTTCGACCCGGCCACCGGGGCGATCACCGGGAAGGGCAGCCTGGCC
GGGGTGAGCGACCCCTCCTTTCTCGCCTCGGCGCCCGGCCACCTCTACGCGGTCAACGAG
CAGCAGGGCTCGGTCACCGCGATCGCCGTGCGGGACGGCGAGTTGAGCGTCCTCGGCAGC
AGCCCCACCGGCGGCGAGGGACCCTGCCATCTGCTGGTCCACGGCGAGGGCGGCCACGTC
CTGAGCGCCAACTACACCTCGGGCAGCGTGAGCGTCCACCCCCTCGCGGCGGACGGGAGC
CTGCGGGAGGCCAGCGACCTCGTCCAGCACACCGGCTCGGGTCCGGACCCGGACCGCCAG
GAGGGCCCGCACGCGCACATGGTCCTGGGCACGCCCTCCGGCCGGTTCGTCCTCGCGGTC
GACCTGGGCACGGACAGCGTCTACACCTACCGCCTGGACACCGGCACCGGGAAGCTCGAA
GCCGTCGTCCAGAACCGGGTGACCCCCGGGCTCGGCCCCCGGCACGCGGCCTTCCACCCC
GGCGGCAGCCACCTGTACGTGGCCAATGAACTGGGCGACTCCCTCTCGGTCTGCTCCTAC
GACGACGCGAGCGGCGAGATCACCGTCCTGGACTCCCTGCCGACCGTGCCGTCCGGCGAT
CCCGCCGGGGAGCGCAACTACCCGGCCGAGGTCCTGCTCTCCCCCGACGGCGCCTACGTC
TATGTCTCCAACCGGGGCCACGACAGCATCGCGCGCTTCGCGGTGGGCGGCGGCGGGGGT
GAGCTGACCCTGCTCGACACGGTGCCCGCCCAGGGCTCCTACCCGCGCCACATCTCGCTG
GACCCGACCGGCCGCTGGCTGTTCGCCGCGAACCAGAAGTCGGGCAGCGTCGGCGTCTTC
GCCCGGGACGAGGCCACCGGCACCCTCAAGGCCGTCGGTACCCCCTTCGCGGCCCCGACT
CCGGTGTGCGTCCTGCCTGTTGCGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-41]  PS51318
PS51318   TAT
IPR011048 Cytochrome cd1-nitrite reductase-like, C-terminal haem d1 (Domain)
 [62-388]  3.80000697093588e-43 SSF51004
SSF51004   Cyt_cd1_haem_C
IPR015943 WD40/YVTN repeat-like-containing domain (Domain)
 [47-387]  1.39999999999997e-113 G3DSA:2.130.10.10
G3DSA:2.130.10.10   WD40/YVTN_repeat-like
IPR019405 Lactonase, 7-bladed beta propeller (Family)
 [47-385]  6.20000000000009e-114 PF10282
PF10282   Lactonase
SignalP
 [1-38]  0.681 Signal
Bacteria, Gram-positive   
 [1-38]  0.739 Signal
Bacteria, Gram-negative   
TMHMM No significant hit