close all open/close all

CDS information : Salino3_00440


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction121,783 / 120,227 / - [in whole cluster]
121,783 / 120,227 / - [in contig]
Locationcomplement(120227..121783) [in whole cluster]
complement(120227..121783) [in contig]
TypeCDS
Length1,557 bp (518 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative beta-hexosaminidase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf23

close this sectionSequence

selected fasta
>[putative beta-hexosaminidase]
MHLHRPELALVPRPRFLSAHRTGAFRLDTGTGLRLGPGTEPAARLLRTLLAPATGLPLPA
AADGAFVLVLDPALSGLGEEGYGLTVSPHRVLLRAARPAGLLRGVQTVRQLLPPQALAAD
PQPGVEWALPCVEISDVPRHPWRGAMLDVARHFQPVSYLRRYVDLLALHKLNVFHLHLTD
DQGWRMPVAAHPRLTEIGGHRAESMIGPSRSTRYDGTPHGGAYTAAELRELVAYAAARGV
TVVPEIEMPGHVRAALAAYPELGNDPGSTLDVWTRWGVCENTLGVSDHVLDFFRTVLDET
MEIFPSEHVHIGGDECPTTEWERSPAALDRVRREGLAGPGALHPWFMQRMTDHLVRAGRR
PVAWAENGTTLPEECTVMSWREPAHAWAAARRGQHVVFADHRATYFDYAREEGDPGLLAQ
SGLVVDLPAVHGLDLTPPGDGAAAADRVLGASGQLWTELVATPAHIEYLVYPRLCALADR
VWGGAGDYADFTARLDGHRTRLDALEVPHARPPFATAA
selected fasta
>[putative beta-hexosaminidase]
GTGCACCTGCACCGCCCGGAACTCGCCCTGGTCCCCCGCCCCCGCTTCCTCAGCGCCCAC
CGCACCGGCGCCTTCCGCCTGGACACCGGCACCGGGCTGCGCCTCGGCCCCGGCACCGAA
CCGGCCGCGCGGCTCCTGCGCACCCTGCTCGCCCCGGCCACCGGGCTGCCGCTGCCCGCC
GCCGCGGACGGCGCCTTCGTCCTCGTCCTGGATCCCGCGCTCAGCGGACTGGGCGAGGAG
GGGTACGGGCTGACCGTCAGCCCGCACCGAGTACTGCTGCGGGCGGCGCGGCCGGCCGGG
CTGCTGCGCGGGGTGCAGACGGTGCGGCAGCTGCTGCCGCCGCAGGCGCTCGCCGCAGAT
CCGCAGCCGGGCGTGGAGTGGGCGCTGCCGTGCGTGGAGATCTCCGATGTGCCCCGGCAC
CCCTGGCGCGGCGCGATGCTCGATGTCGCCCGCCACTTCCAGCCCGTCTCCTATCTGCGG
CGCTATGTGGACCTGCTCGCCCTGCACAAGCTGAACGTCTTCCATCTGCACCTCACCGAC
GACCAGGGCTGGCGGATGCCCGTCGCCGCCCACCCCCGGCTCACCGAGATCGGCGGCCAC
CGCGCCGAGTCGATGATCGGGCCCTCCCGCAGCACCCGCTACGACGGGACGCCGCACGGC
GGGGCCTACACCGCGGCCGAGTTGCGGGAGCTGGTGGCCTACGCGGCGGCCCGCGGGGTG
ACGGTGGTCCCCGAGATCGAGATGCCCGGCCATGTGCGCGCCGCCCTCGCCGCCTACCCC
GAGCTGGGCAACGACCCGGGGAGCACCCTCGATGTCTGGACCCGCTGGGGCGTCTGCGAG
AACACCCTCGGCGTCTCGGACCACGTCCTCGACTTCTTCCGTACCGTCCTGGACGAGACC
ATGGAGATCTTCCCCTCCGAGCATGTGCACATCGGCGGGGACGAGTGCCCGACCACCGAG
TGGGAGCGCAGCCCGGCCGCGCTCGACCGGGTCCGCCGGGAGGGCCTGGCGGGTCCCGGG
GCGCTGCACCCCTGGTTCATGCAGCGGATGACCGACCACCTGGTACGGGCCGGGCGGCGG
CCGGTGGCCTGGGCCGAGAACGGGACCACGCTGCCCGAGGAGTGCACGGTGATGAGCTGG
CGCGAGCCCGCGCACGCCTGGGCGGCGGCCCGGCGCGGCCAGCACGTCGTCTTCGCCGAC
CACCGCGCCACCTACTTCGACTACGCCCGCGAGGAGGGCGATCCGGGGCTGCTCGCCCAG
TCCGGCCTGGTGGTCGACCTGCCCGCCGTGCACGGACTCGACCTGACGCCGCCCGGGGAC
GGGGCCGCCGCCGCGGACCGCGTCCTCGGCGCCTCCGGCCAGTTGTGGACCGAACTGGTC
GCCACCCCCGCGCACATCGAGTACCTGGTCTACCCCCGGCTGTGCGCCCTGGCCGACCGG
GTCTGGGGCGGTGCGGGCGACTACGCGGACTTCACCGCCCGCCTGGACGGGCACCGCACC
CGGCTCGACGCGCTCGAGGTCCCGCACGCCCGGCCGCCCTTCGCCACCGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013781 Glycoside hydrolase, catalytic domain (Domain)
 [138-513]  3.70000000000004e-111 G3DSA:3.20.20.80
G3DSA:3.20.20.80   Glyco_hydro_cat
IPR015883 Glycoside hydrolase family 20, catalytic core (Domain)
 [141-483]  1.29999999999998e-94 PF00728
PF00728   Glyco_hydro_20
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [140-495]  1.50000965748778e-99 SSF51445
SSF51445   Glyco_hydro_cat
IPR025705 Beta-hexosaminidase subunit alpha/beta (Family)
 [91-111]  5.6999970878395e-44 PR00738 [134-151]  5.6999970878395e-44 PR00738 [163-184]  5.6999970878395e-44 PR00738 [234-251]  5.6999970878395e-44 PR00738 [304-317]  5.6999970878395e-44 PR00738 [448-464]  5.6999970878395e-44 PR00738 [466-483]  5.6999970878395e-44 PR00738
PR00738   GLHYDRLASE20
SignalP No significant hit
TMHMM No significant hit