close all open/close all

CDS information : Salino3_00460


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction123,713 / 122,727 / - [in whole cluster]
123,713 / 122,727 / - [in contig]
Locationcomplement(122727..123713) [in whole cluster]
complement(122727..123713) [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative sugar transporter membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf25

close this sectionSequence

selected fasta
>[putative sugar transporter membrane protein]
MSIVHEPGTPPPAAAPAARRRPRPPADRPRASDRNSPWAYVLIAPAVAGMLYLLLYPLAR
AVVISFQDFRLRQLIVGDASFVGLRNYRELLGDARFWEVVRRTFLFMAVNVVLIMVLSML
VALMIERLGRFGRTVVLGSLVLVWAMPVIAATTVFQWLFHSRFGIVNEVLVSLGFSSYEG
YAWLAHDKAAFAIIVTLIVWQSVPFAAITLYSALTTVPRELYESARIDGAGAGRLFRSVT
FPLIRPLFMLVLSLEVIWTFKAFVQIWVMTKGGPGDATTILPVYAVQTALSNQRYDLSSA
ASMVTVLLMSGVLVFYFRQLFRQEGEHL
selected fasta
>[putative sugar transporter membrane protein]
GTGTCCATCGTCCACGAGCCGGGCACCCCGCCACCGGCCGCCGCCCCCGCGGCCCGGCGG
CGGCCCCGGCCCCCGGCGGACCGGCCCCGCGCGAGCGACCGGAACTCGCCCTGGGCCTAC
GTACTGATCGCCCCCGCCGTGGCGGGCATGCTCTACCTGCTCCTGTATCCGCTGGCGCGG
GCCGTGGTGATCTCCTTCCAGGACTTCCGGCTGCGCCAACTGATCGTCGGTGACGCCTCC
TTCGTGGGGCTGCGCAACTACCGGGAGCTGCTCGGCGACGCCCGCTTCTGGGAGGTCGTC
CGCCGGACCTTCCTCTTCATGGCCGTCAACGTCGTCCTCATCATGGTGCTCTCGATGCTG
GTGGCGCTGATGATCGAGCGGCTGGGCCGCTTCGGGCGGACGGTGGTGCTCGGCTCGCTG
GTGCTGGTCTGGGCGATGCCGGTGATCGCCGCGACCACCGTCTTCCAGTGGCTCTTCCAC
TCCCGCTTCGGCATCGTCAACGAGGTCCTCGTCAGCCTCGGCTTCAGCTCCTACGAGGGC
TACGCCTGGCTCGCGCACGACAAGGCGGCCTTCGCCATCATCGTGACGCTGATCGTCTGG
CAGTCGGTGCCCTTCGCCGCGATCACCCTCTACTCGGCGCTGACCACCGTGCCGCGCGAG
CTGTACGAGTCGGCGCGGATCGACGGGGCGGGCGCGGGGCGGCTGTTCCGCTCGGTGACC
TTCCCGCTGATCCGGCCGCTGTTCATGCTGGTGCTGTCCCTGGAGGTGATCTGGACCTTC
AAGGCCTTCGTGCAGATCTGGGTGATGACCAAGGGCGGCCCCGGCGACGCCACCACCATC
CTGCCCGTCTACGCGGTGCAGACCGCCCTGTCCAACCAGCGCTACGACCTCAGCTCCGCG
GCCTCCATGGTCACCGTGCTGCTCATGAGCGGCGTCCTCGTCTTCTACTTCCGCCAGCTG
TTCCGTCAGGAGGGCGAGCACCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [117-316]  1.1e-15 PF00528
PF00528   BPD_transp_1
 [100-316]  PS50928
PS50928   ABC_TM1
SignalP No significant hit
TMHMM
 [37-59]  Transmembrane (i-o) [103-125]  Transmembrane (o-i) [137-159]  Transmembrane (i-o) [189-211]  Transmembrane (o-i) [247-269]  Transmembrane (i-o) [300-317]  Transmembrane (o-i)
Transmembrane 6