close all open/close all

CDS information : Salino3_00470


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction125,026 / 123,761 / - [in whole cluster]
125,026 / 123,761 / - [in contig]
Locationcomplement(123761..125026) [in whole cluster]
complement(123761..125026) [in contig]
TypeCDS
Length1,266 bp (421 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative sugar transporter sugar binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf26

close this sectionSequence

selected fasta
>[putative sugar transporter sugar binding protein]
MSYRPLVLLGAAALSLSLAACSSSGDSGGGEGGRTGVDVWLMRGSVSAAFQKQFETGFEK
AHPDIDLKIQIQEWNGIGEKVTAALASNDAPDVIEVGNTQVAQYAQSEGLTDLSDKVGEL
GGDAWVKGLAEPGTYEKKQYGIPYYAANRVVVYRKDLFEKAGVDASKITTREQWIKATEK
VNKGATQGIYLPGQNWYALAGFIWDEGGDLAVNRNGTWQGGLDSPQALKGMEFYERLQAL
GKGPKDSDEAQPPQAEVMAKGDTAQIIAVPGAADIVTENNPELKDKLGFFPIPGKSADKP
GAVFTGGSDLVVPAAAAHQDEAYTMIKELTGDAWQKKLARTMSYVPNKVTLAEAVNSEPG
AAAMAIGAVNGRATPNTPEWAAVEAKNPIKNYMTAVLTGGNAKSEAAKASRTITGALAGG
S
selected fasta
>[putative sugar transporter sugar binding protein]
ATGTCGTATCGCCCGCTCGTCCTGCTCGGAGCCGCCGCACTGAGCCTTTCGCTGGCCGCC
TGCTCCTCCTCCGGTGACTCCGGCGGCGGGGAGGGCGGCAGGACCGGAGTGGATGTGTGG
CTGATGCGCGGCAGCGTCTCGGCGGCCTTCCAGAAGCAGTTCGAGACCGGCTTCGAGAAG
GCGCATCCGGACATCGACCTGAAGATCCAGATCCAGGAGTGGAACGGCATCGGCGAGAAG
GTCACCGCCGCGCTGGCAAGCAACGACGCCCCGGACGTCATCGAGGTCGGCAACACCCAG
GTCGCCCAGTACGCCCAGAGCGAGGGCCTGACCGACCTCTCGGACAAGGTCGGGGAACTC
GGCGGCGACGCCTGGGTCAAGGGCCTCGCCGAGCCGGGTACCTACGAGAAGAAGCAGTAC
GGGATCCCGTACTACGCGGCCAACCGGGTCGTGGTCTACCGCAAGGACCTCTTCGAGAAG
GCCGGGGTGGACGCCTCGAAGATCACCACCCGGGAGCAGTGGATCAAGGCCACCGAGAAG
GTCAACAAGGGGGCCACGCAGGGCATCTACCTGCCCGGGCAGAACTGGTACGCCCTGGCC
GGGTTCATCTGGGACGAGGGCGGCGACCTCGCGGTGAACCGCAACGGCACGTGGCAGGGC
GGCCTGGACAGCCCGCAGGCGCTCAAGGGCATGGAGTTCTACGAGCGGCTCCAGGCACTC
GGCAAGGGCCCCAAGGACTCCGACGAGGCGCAGCCGCCGCAGGCCGAGGTGATGGCCAAG
GGCGACACCGCGCAGATCATCGCGGTGCCCGGGGCCGCCGACATCGTCACCGAGAACAAC
CCGGAGCTCAAGGACAAGCTGGGCTTCTTCCCCATCCCGGGCAAGAGCGCCGACAAGCCG
GGGGCCGTCTTCACCGGCGGCTCCGACCTGGTCGTCCCGGCCGCCGCCGCGCACCAGGAC
GAGGCGTACACCATGATCAAGGAACTCACCGGCGACGCCTGGCAGAAGAAGCTGGCGCGG
ACCATGAGCTATGTGCCCAACAAGGTCACCCTCGCCGAGGCGGTCAACTCCGAACCGGGC
GCGGCGGCGATGGCGATCGGAGCCGTCAACGGCCGGGCCACGCCCAACACCCCGGAGTGG
GCCGCGGTCGAGGCGAAGAACCCGATCAAGAACTACATGACCGCGGTGCTCACCGGCGGC
AACGCCAAGAGCGAGGCGGCGAAGGCCTCCCGCACCATCACCGGCGCGCTCGCCGGCGGC
TCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006059 Bacterial extracellular solute-binding, family 1 (Family)
 [48-336]  2.89999999999999e-41 PF01547
PF01547   SBP_bac_1
SignalP
 [1-25]  0.585 Signal
Bacteria, Gram-positive   
 [1-19]  0.714 Signal
Eukaryota   
 [1-19]  0.691 Signal
Bacteria, Gram-negative   
TMHMM No significant hit