close all open/close all

CDS information : Salino3_00480


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction126,194 / 125,286 / - [in whole cluster]
126,194 / 125,286 / - [in contig]
Locationcomplement(125286..126194) [in whole cluster]
complement(125286..126194) [in contig]
TypeCDS
Length909 bp (302 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf27

close this sectionSequence

selected fasta
>[putative hydrolase]
MTLSALAAGTALLCLPSAATAAPALPRGTAPAADAPALFDDFAYTDSADPALADHGWSVR
GGSGGPGVPGAVWDPAQVTFRTAEGSSVLDLETSTAGTPESTRQTEILTRSQKFQNGTYA
ARVHFSDAPESGPDGDRVVQTFFTINDLKAPMADDYAEYDFEYLPNGGWGEPSSTLFTTS
WETYNPEPWEAVNQHSESRTSFAGWHDLVMTIDGGAITYWIDGSVFATHDAAYLPERPMS
INFNQWLIDLEGQPDTGPRSYHQQVDYVLHVKDENLTPDQVGAEVEAYRAAGTSFVDEVP
AP
selected fasta
>[putative hydrolase]
GTGACACTGTCCGCGCTGGCCGCGGGCACCGCCCTGCTCTGCCTGCCGTCCGCCGCCACG
GCCGCCCCCGCACTCCCCCGCGGCACCGCCCCGGCGGCGGACGCGCCCGCCCTCTTCGAC
GACTTCGCCTACACCGACTCGGCCGATCCCGCCCTCGCGGACCACGGCTGGAGCGTGCGC
GGCGGCTCCGGCGGCCCGGGGGTGCCGGGTGCCGTCTGGGACCCGGCGCAGGTCACCTTC
CGTACGGCGGAGGGGAGTTCGGTGCTCGACCTGGAGACCTCGACGGCCGGGACGCCCGAG
TCCACCCGGCAGACCGAGATCCTCACCAGGAGCCAGAAGTTCCAGAACGGCACCTATGCG
GCGCGGGTGCACTTCAGCGACGCCCCGGAGTCCGGACCCGACGGCGACCGGGTGGTGCAG
ACCTTCTTCACCATCAACGATCTCAAGGCCCCGATGGCCGACGACTACGCCGAGTACGAC
TTCGAGTACCTGCCCAACGGCGGCTGGGGCGAGCCCTCCAGCACCCTCTTCACCACCTCC
TGGGAGACCTACAACCCCGAGCCCTGGGAGGCCGTCAACCAGCACAGCGAGAGCCGGACC
TCCTTCGCGGGCTGGCACGACCTGGTGATGACCATCGACGGCGGGGCCATCACGTACTGG
ATCGACGGCAGCGTCTTCGCCACGCACGACGCCGCGTACCTTCCCGAGCGCCCGATGTCG
ATCAACTTCAACCAGTGGCTCATCGACCTCGAGGGGCAGCCGGACACCGGCCCGCGCTCC
TACCACCAGCAGGTCGACTACGTCCTGCACGTCAAGGACGAGAATCTGACGCCGGATCAG
GTGGGGGCGGAGGTCGAGGCCTACCGCGCGGCCGGGACCTCCTTCGTGGACGAGGTCCCG
GCGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008985 Concanavalin A-like lectin/glucanase (Domain)
 [39-273]  2.70000183580794e-17 SSF49899
SSF49899   ConA_like_lec_gl
IPR013320 Concanavalin A-like lectin/glucanase, subgroup (Domain)
 [38-268]  1e-17 G3DSA:2.60.120.200
G3DSA:2.60.120.200   ConA_like_subgrp
SignalP
 [1-21]  0.827 Signal
Eukaryota   
 [1-21]  0.89 Signal
Bacteria, Gram-negative   
 [1-32]  0.734 Signal
Bacteria, Gram-positive   
TMHMM No significant hit