close all open/close all
Salino3_00480 Salino3_00480   last last

CDS information : Salino3_00490


close this sectionLocation

Organism
StrainXM211
Entry nameSalinomycin
Contig
Start / Stop / Direction126,616 / 127,455 / + [in whole cluster]
126,616 / 127,455 / + [in contig]
Location126616..127455 [in whole cluster]
126616..127455 [in contig]
TypeCDS
Length840 bp (279 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in salinomycin biosynthesis.
Note (GenBank)
  • Orf28

close this sectionSequence

selected fasta
>[putative transcriptional regulator]
MEIPETTSGAVLKRERVRAAILEIIEERHPGAVIPSERVLCARLGVSRPTLRAAVDEFVR
AGRLVREHGRGVFVAAEKITQELVPGAEVLSVPPAAGVWTSRLLETAIRPAGARVGRKLR
LSPAAPIRHLTRLRLVDGAPMAIEYLHLPAELVPALTEAELEDGDLYAHLRARHGVEVAE
ADQSIEPTVTTEAEAALLEVPVLSPALLFERLTSDRAGRLVEYVHSLYRGDRYRIRSRLT
LSPSGAPQPPEAHHPGIPPGDFAPDRPVSFSAHGVVQDG
selected fasta
>[putative transcriptional regulator]
ATGGAGATCCCCGAGACCACCTCCGGGGCCGTCCTGAAGCGGGAGCGGGTGCGCGCCGCG
ATCCTGGAGATCATCGAGGAGCGGCACCCCGGAGCGGTGATCCCCTCGGAGCGCGTCCTG
TGCGCCCGGCTCGGCGTCTCGCGGCCCACCCTGCGCGCCGCCGTCGACGAGTTCGTCCGC
GCCGGACGGCTGGTACGCGAACACGGCAGGGGCGTCTTCGTCGCCGCGGAGAAGATCACC
CAGGAGCTGGTCCCCGGCGCCGAGGTGCTGAGCGTTCCACCGGCCGCGGGCGTCTGGACC
AGCAGGCTCCTGGAGACGGCGATCCGCCCGGCCGGGGCGCGGGTGGGCCGCAAGCTGCGC
CTCTCGCCCGCCGCGCCGATCCGGCACCTCACCCGGCTGCGCCTCGTCGACGGCGCGCCC
ATGGCGATCGAGTACCTGCACCTGCCCGCCGAGCTGGTCCCGGCGCTCACCGAGGCGGAG
TTGGAGGACGGCGACCTCTACGCCCACCTGCGCGCACGGCACGGCGTCGAGGTCGCGGAG
GCCGACCAGTCCATCGAGCCCACCGTCACCACCGAGGCGGAGGCCGCGCTCCTGGAGGTC
CCGGTGCTCTCCCCGGCGCTCCTCTTCGAACGCCTCACCTCGGACCGCGCGGGACGCCTG
GTCGAGTACGTGCACTCGCTCTACCGCGGCGACCGCTACCGCATCCGCTCCCGGCTCACC
CTCAGCCCCTCCGGCGCCCCGCAGCCGCCCGAGGCGCACCATCCCGGTATCCCGCCCGGG
GATTTCGCCCCCGACCGGCCTGTGTCATTCTCGGCGCACGGCGTGGTGCAGGACGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000524 Transcription regulator HTH, GntR (Domain)
 [34-48]  8.29999581180008e-06 PR00035 [48-64]  8.29999581180008e-06 PR00035
PR00035   HTHGNTR
 [17-74]  6.80000200614766e-12 SM00345
SM00345   HTH_GNTR
 [7-77]  PS50949
PS50949   HTH_GNTR
 [15-74]  1.1e-11 PF00392
PF00392   GntR
IPR011663 UbiC transcription regulator-associated (Domain)
 [99-234]  1.70000000000001e-37 PF07702
PF07702   UTRA
 [95-234]  2.39999798157265e-37 SM00866
SM00866   UTRA
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [14-69]  2.9e-15 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit
Salino3_00480 Salino3_00480   last last