close all open/close all

CDS information : Salino_00020


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction674 / 1,636 / + [in whole cluster]
674 / 1,636 / + [in contig]
Location674..1636 [in whole cluster]
674..1636 [in contig]
TypeCDS
Length963 bp (320 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)electron transfer flavoprotein, alpha subunit
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[electron transfer flavoprotein, alpha subunit]
MAEVLVYVDHVDGAVRKPTLELLTLARRLGEPVAVALGAGAESTAAVLGEHGAVRVLTAD
APEFADYLVVPKVDALQAAYDAVSPAAVLVPSSAEGKEIAARLAVRIGSGIITDAVDLEA
GDEGPVATQSAFAASFTTKSRVSRGTPVITVKPNSAAVEPAQAAGTVEALSVSFGEKSTG
TKVVSRTPRQSTGRPDLTEAAIVVSGGRGVNGAENFPVIEALADSLGAAVGASRAAVDAG
WYPHTNQVGQTGKSVSPQLYIANGISGAIQHRAGMQTSKTIVAVNKDEEAPIFDLVDFGV
VGDLFNVVPQLTEEIKTRKG
selected fasta
>[electron transfer flavoprotein, alpha subunit]
ATGGCTGAAGTTCTCGTCTATGTCGACCACGTGGACGGTGCCGTCCGCAAGCCCACCCTG
GAGCTGCTGACGCTGGCCCGCCGTCTCGGCGAGCCGGTCGCGGTCGCCCTCGGCGCGGGT
GCCGAGTCCACCGCCGCCGTCCTGGGTGAGCACGGTGCGGTACGCGTGCTGACCGCGGAC
GCCCCGGAGTTCGCCGACTACCTCGTCGTGCCGAAGGTGGACGCGCTGCAGGCCGCCTAC
GACGCAGTCTCCCCGGCTGCCGTCCTGGTGCCGTCCTCGGCGGAGGGCAAGGAGATCGCC
GCCCGTCTGGCGGTCCGTATCGGTTCGGGCATCATCACCGACGCCGTGGACCTGGAGGCC
GGGGACGAGGGTCCGGTCGCGACCCAGTCCGCGTTCGCCGCCTCGTTCACCACCAAGTCC
CGTGTGTCCAGGGGCACTCCGGTCATCACGGTGAAGCCGAACTCGGCCGCGGTCGAGCCG
GCCCAGGCCGCGGGCACGGTCGAGGCGCTGTCGGTGTCCTTCGGTGAGAAGTCCACCGGT
ACCAAGGTCGTCTCGCGTACGCCGCGTCAGTCGACCGGCCGTCCGGACCTGACCGAGGCC
GCGATCGTCGTCTCGGGTGGCCGTGGTGTCAACGGCGCCGAGAACTTCCCGGTCATCGAG
GCCCTCGCGGACTCCCTCGGTGCCGCGGTGGGCGCCTCGCGCGCGGCGGTGGACGCGGGC
TGGTACCCGCACACCAACCAGGTGGGCCAGACCGGTAAGTCGGTCTCGCCGCAGCTGTAC
ATCGCCAACGGCATCTCGGGTGCGATCCAGCACCGTGCCGGTATGCAGACCTCGAAGACC
ATCGTCGCGGTCAACAAGGACGAGGAGGCGCCGATCTTCGACCTCGTCGACTTCGGTGTG
GTCGGCGACCTCTTCAACGTCGTCCCGCAGCTGACTGAGGAGATCAAGACCCGCAAGGGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001308 Electron transfer flavoprotein, alpha subunit (Family)
 [1-320]  2.39999798157263e-121 PIRSF000089
PIRSF000089   Electra_flavoP_a
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [3-185]  1.6e-41 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
IPR014730 Electron transfer flavoprotein, alpha/beta-subunit, N-terminal (Domain)
 [4-156]  1.3e-27 PF01012
PF01012   ETF
 [4-187]  1.10000150671642e-26 SM00893
SM00893   ETF
IPR014731 Electron transfer flavoprotein, alpha subunit, C-terminal (Domain)
 [195-279]  1.2e-36 PF00766
PF00766   ETF_alpha
IPR018206 Electron transfer flavoprotein, alpha subunit, C-terminal, conserved site (Conserved_site)
 [259-285]  PS00696
PS00696   ETF_ALPHA
SignalP No significant hit
TMHMM No significant hit