close all open/close all

CDS information : Salino_00040


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction3,147 / 4,901 / + [in whole cluster]
3,147 / 4,901 / + [in contig]
Location3147..4901 [in whole cluster]
3147..4901 [in contig]
TypeCDS
Length1,755 bp (584 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative protein serine/threonine kinase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[putative protein serine/threonine kinase]
MVDTGEHQEAHGAGRLLAGRYRTVAQLGRGGMGVVWRAVDEVLGREVAVKELRTYTDTAG
AELADMQLRMQREARAAARVRHPGVIAVHDVTQVEGRPLIVMELVDGPSLDDILRERGVL
DPREAAALGADVLEALAAAHAVGVLHRDVKPGNILRDRSGRTVLTDFGIATMDDPGDGST
SHLTRSGEIVGSLDFLAPERAQGQQPGPASDLWAVGATLYAAVEGASPFRRTSTWSTLSA
IVAEPLPVPRRAGALMPVLERLLHKDPRWRPGAEEAAAQLRAVAAGQTAPLPPGPEAERP
TAPNSPLPQGGYGYPPAAPPAAGFGPPAAGAAFGEAPAAHRAGAPGTWEQGAPATPYGPG
HPPTGQPPRRDTLPQPRRGERKRRGPVLLVAVAVTVVLAVAGTGIALMNSSDGTADEAGS
SGGTSSGSAREPSAEGSPGALGDEKKPSARPRPEKGGDRPAASAKPDSPAGTGKAPRPKP
KPTGRPGGDAAPVCHDIGGGKFTCQVWRTATSYTAAGAEAGILRAGTNYFFCQQNLGRRE
NAGKYTNIWSAKTDDDSGNTQVFVNVVNIKGGADDAPVPGLPYC
selected fasta
>[putative protein serine/threonine kinase]
GTGGTGGACACGGGGGAGCACCAGGAGGCGCACGGCGCGGGCAGACTGCTCGCCGGGCGC
TACCGGACCGTAGCGCAGCTCGGCCGGGGCGGGATGGGCGTCGTCTGGCGGGCCGTGGAC
GAGGTCCTCGGCCGCGAGGTCGCCGTCAAGGAGCTGCGGACCTACACGGACACCGCGGGC
GCCGAACTCGCCGATATGCAGCTGCGGATGCAGCGCGAGGCCCGCGCGGCGGCCCGGGTG
CGCCATCCCGGGGTGATCGCGGTGCACGATGTGACCCAGGTCGAGGGCCGACCGCTGATC
GTGATGGAGCTCGTGGACGGGCCCTCCCTCGACGACATACTCCGCGAGCGCGGCGTCCTC
GACCCGCGCGAGGCCGCCGCCCTCGGCGCCGATGTCCTCGAAGCCCTCGCCGCGGCGCAC
GCGGTGGGCGTCCTGCACCGCGATGTGAAGCCGGGCAACATCCTCCGCGACCGCTCGGGC
CGCACCGTGCTCACCGACTTCGGCATCGCCACCATGGACGACCCCGGGGACGGCTCCACC
TCCCATCTGACCCGCAGCGGCGAGATCGTCGGCTCCCTCGACTTCCTGGCCCCGGAGCGC
GCCCAGGGGCAGCAACCGGGTCCCGCCTCCGACCTCTGGGCGGTGGGCGCCACCCTGTAC
GCGGCCGTGGAAGGCGCCTCCCCCTTCCGCCGTACGTCCACCTGGTCGACGCTCTCCGCG
ATCGTCGCCGAGCCGCTGCCCGTACCGCGGCGCGCCGGGGCGCTGATGCCGGTACTGGAG
CGGCTGCTGCACAAGGACCCGCGGTGGCGGCCGGGGGCCGAGGAGGCGGCGGCGCAGCTG
CGCGCGGTCGCGGCCGGGCAGACGGCACCGCTGCCGCCGGGACCTGAGGCCGAGCGGCCC
ACCGCCCCGAACTCCCCGCTGCCCCAAGGGGGTTACGGATACCCGCCCGCGGCGCCTCCC
GCGGCCGGGTTCGGCCCGCCCGCCGCCGGAGCCGCCTTCGGCGAGGCGCCCGCGGCCCAC
CGGGCGGGCGCGCCCGGCACCTGGGAGCAGGGGGCGCCCGCGACGCCGTACGGGCCGGGG
CACCCCCCGACCGGGCAGCCGCCCCGGCGGGACACCCTTCCGCAGCCGCGGCGCGGTGAG
AGGAAGCGCCGTGGTCCGGTCCTCCTGGTCGCCGTGGCGGTGACCGTGGTGCTGGCCGTC
GCCGGGACCGGTATCGCCCTGATGAACAGCTCGGACGGGACCGCCGACGAGGCCGGGAGC
AGTGGCGGGACGTCATCCGGGAGCGCTCGCGAGCCCTCGGCCGAGGGGAGCCCCGGCGCC
CTCGGCGACGAGAAGAAGCCCTCGGCCCGGCCCCGCCCGGAGAAGGGCGGCGACCGGCCC
GCCGCCTCCGCGAAGCCGGACTCCCCGGCCGGTACGGGCAAGGCGCCCCGGCCGAAGCCG
AAGCCCACCGGCCGGCCGGGCGGGGACGCGGCACCGGTCTGCCACGACATCGGCGGCGGG
AAGTTCACCTGCCAGGTGTGGCGCACCGCGACCTCGTACACCGCGGCCGGGGCCGAGGCG
GGGATCCTGCGCGCGGGCACCAACTACTTCTTCTGCCAGCAGAACCTCGGCCGCCGGGAG
AACGCGGGCAAGTACACCAACATCTGGTCCGCCAAGACCGACGACGACAGCGGCAACACC
CAGGTCTTCGTGAACGTGGTCAACATCAAGGGCGGCGCCGACGACGCCCCGGTGCCCGGA
CTGCCGTACTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000719 Protein kinase, catalytic domain (Domain)
 [21-283]  PS50011
PS50011   PROTEIN_KINASE_DOM
 [21-277]  8.50000000000004e-46 PF00069
PF00069   Pkinase
IPR011009 Protein kinase-like domain (Domain)
 [7-311]  1.39999277195148e-71 SSF56112
SSF56112   Kinase_like
IPR017441 Protein kinase, ATP binding site (Binding_site)
 [27-50]  PS00107
PS00107   PROTEIN_KINASE_ATP
SignalP No significant hit
TMHMM
 [385-407]  Transmembrane (i-o)
Transmembrane 1