close all open/close all

CDS information : Salino_00050


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction5,912 / 4,926 / - [in whole cluster]
5,912 / 4,926 / - [in contig]
Locationcomplement(4926..5912) [in whole cluster]
complement(4926..5912) [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)LacI family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[LacI family transcriptional regulator]
MKDVAARAGVGLKTVSRVVNGESGVTADTERRVQEAIEALGFRRNDSARVLRKGRTSSIG
LVLEDLADPFYGPLSRAVEEVARAHGALLINGSSAEDPDREQELALALCARRVDGLVIIP
AGDDHRYLEPELRAGVATVFVDRPAGGIDADVVLSDNYGGSYTGTAHLIAHGHRRIGFIG
DQVGIHTAAERLRGYQAAMEDAGLPVHESWVSSGDTHPERVRKAAESMLTGSEPVTALFA
GNNRVTVTAVRVLAGPGHHAALVGFDDFELADLLSPAVTVVAQDSAQIGRTAAERLFRRL
GGTPLEAERIELPVRLIARGSGELPPAG
selected fasta
>[LacI family transcriptional regulator]
ATGAAGGATGTGGCCGCCCGGGCGGGGGTCGGGCTCAAGACGGTCTCGCGGGTGGTCAAC
GGCGAGTCGGGAGTCACCGCCGACACCGAGCGGCGGGTCCAGGAGGCGATCGAGGCCCTC
GGCTTCCGGCGCAACGACAGCGCCCGGGTGCTGCGCAAGGGCCGCACCTCCAGCATCGGC
CTGGTCCTGGAGGATCTCGCGGACCCCTTCTACGGCCCGCTCAGCCGCGCGGTGGAGGAG
GTCGCCCGCGCCCACGGCGCCCTGCTCATCAACGGTTCCAGCGCCGAAGACCCGGACCGC
GAGCAGGAGTTGGCGCTCGCCCTGTGCGCGCGGCGGGTGGACGGGCTGGTGATCATCCCG
GCCGGGGACGACCACCGCTATCTGGAGCCCGAGCTGCGGGCCGGGGTCGCCACCGTCTTC
GTCGACCGCCCCGCGGGCGGCATCGACGCCGACGTGGTGCTGTCCGACAACTACGGCGGC
TCCTACACCGGCACCGCCCACCTCATCGCCCACGGCCACCGCCGGATCGGCTTCATCGGC
GACCAGGTCGGCATCCACACCGCCGCCGAGCGCCTGCGCGGCTACCAGGCGGCGATGGAG
GACGCCGGGCTCCCCGTGCACGAGAGCTGGGTCTCCTCCGGGGACACCCACCCGGAGCGG
GTCCGCAAGGCCGCCGAGTCGATGCTCACCGGCAGCGAGCCGGTGACCGCCCTCTTCGCG
GGCAACAACCGGGTGACGGTGACCGCCGTGCGGGTGCTCGCCGGACCCGGGCACCACGCG
GCGCTGGTCGGCTTCGACGACTTCGAACTGGCCGATCTGCTCAGCCCCGCCGTCACGGTG
GTCGCCCAGGACTCCGCCCAGATAGGGCGCACGGCGGCCGAGCGGCTCTTCCGCCGCCTC
GGCGGCACCCCCCTGGAGGCGGAGCGCATCGAGCTGCCGGTGCGCCTGATCGCCCGGGGC
TCCGGCGAACTGCCGCCCGCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000843 Transcription regulator HTH, LacI (Domain)
 [1-45]  7.90000000000001e-14 PF00356
PF00356   LacI
 [1-53]  PS50932
PS50932   HTH_LACI_2
 [1-68]  1.29999924468179e-22 SM00354
SM00354   HTH_LACI
 [1-19]  PS00356
PS00356   HTH_LACI_1
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [1-55]  1.09999909120787e-14 SSF47413
SSF47413   Lambda_like_DNA
 [1-54]  1.6e-19 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
SignalP
 [1-21]  0.093 Signal
Eukaryota   
TMHMM No significant hit