close all open/close all

CDS information : Salino_00060


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction6,101 / 7,054 / + [in whole cluster]
6,101 / 7,054 / + [in contig]
Location6101..7054 [in whole cluster]
6101..7054 [in contig]
TypeCDS
Length954 bp (317 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[transcriptional regulator]
MHTDLVAALDIGGTKIAGALVDSSGRIVLRGQRPTPAQESGESVMRAVEAVLAELTSSVL
WPAVRAIGIGSAGPVDASAGTVSPVNIPGWRGFPLVDGVRQLTGALPVELVGDGVAIAAA
EHWQGAAKGHDNALCMVVSTGVGGGLVLGGALHSGPTGNAGHIGHISVDLDGDACPCGAR
GCVERIASGPNIARRALAEGWRPAGDAEPTAAAVAAAAEAGDPVAAASFMRAARALAAGI
AATATLVEIDIAVIGGGVAKSGEVLFGPLRAALQEYATLSFVRGLSVAPARMGTDAGLVG
AAAAALGGAPREASVIG
selected fasta
>[transcriptional regulator]
ATGCACACCGACCTCGTCGCCGCGCTCGACATCGGCGGGACCAAGATCGCCGGAGCCCTG
GTCGACAGCAGTGGGCGCATCGTGCTGCGCGGGCAGCGGCCCACCCCGGCCCAGGAGAGC
GGCGAGTCGGTGATGCGTGCCGTCGAGGCGGTGCTCGCCGAGCTGACCTCCTCGGTGCTG
TGGCCCGCCGTACGGGCGATCGGCATCGGCAGCGCGGGTCCGGTGGACGCCTCCGCGGGG
ACGGTGAGCCCGGTCAACATCCCCGGCTGGCGCGGCTTTCCGCTGGTGGACGGCGTACGG
CAACTGACCGGCGCGCTGCCCGTGGAACTGGTCGGCGACGGGGTGGCCATCGCCGCCGCG
GAGCACTGGCAGGGCGCCGCCAAGGGGCATGACAACGCCCTGTGCATGGTGGTCTCCACC
GGAGTCGGCGGCGGGCTGGTCCTCGGCGGGGCGCTGCACTCGGGCCCGACCGGCAACGCG
GGGCACATCGGCCACATCAGCGTGGACCTCGACGGCGACGCCTGCCCCTGCGGGGCGCGC
GGCTGTGTGGAGCGGATCGCGAGCGGGCCGAACATCGCGCGGCGCGCCCTCGCCGAGGGC
TGGCGGCCCGCCGGGGACGCCGAGCCCACCGCCGCCGCGGTGGCCGCCGCGGCCGAGGCC
GGGGACCCGGTCGCGGCCGCCTCCTTCATGCGGGCGGCGCGGGCGCTCGCCGCCGGGATC
GCCGCGACGGCGACCCTGGTGGAGATCGACATCGCCGTGATCGGCGGGGGAGTGGCGAAG
TCCGGCGAGGTCCTCTTCGGGCCGCTGCGGGCGGCACTTCAGGAGTACGCCACCCTGTCC
TTCGTACGCGGCCTGAGCGTCGCCCCCGCCCGGATGGGCACGGACGCCGGACTGGTCGGC
GCGGCCGCCGCGGCGCTCGGCGGTGCGCCGCGCGAGGCGAGCGTCATCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000600 ROK (Family)
 [138-165]  PS01125
PS01125   ROK
 [8-191]  3.80000000000003e-39 PF00480
PF00480   ROK
SignalP
 [1-19]  0.132 Signal
Eukaryota   
TMHMM No significant hit