close all open/close all

CDS information : Salino_00070


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction7,442 / 7,044 / - [in whole cluster]
7,442 / 7,044 / - [in contig]
Locationcomplement(7044..7442) [in whole cluster]
complement(7044..7442) [in contig]
TypeCDS
Length399 bp (132 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)anti-sigma-factor antagonist domain-containing protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[anti-sigma-factor antagonist domain-containing protein]
MQQGDQLVLVAQDPEATPRVHHREGFTVVELHGELDILAFQHTAPLLDALSGEQAPAIVV
DLRRTTFCDCSGLGLLARTSRRAAERGGRVLLVCTHPLQRRILALTGLDRSLPPHTTLDE
ALAAAAAAPVSR
selected fasta
>[anti-sigma-factor antagonist domain-containing protein]
ATGCAGCAGGGGGATCAACTCGTCCTCGTCGCACAGGACCCGGAGGCCACTCCGAGGGTC
CACCACCGCGAGGGCTTCACCGTGGTCGAACTCCACGGCGAGCTCGACATCCTCGCCTTC
CAGCACACCGCGCCGCTCCTCGACGCCCTGAGCGGCGAGCAGGCCCCCGCGATCGTCGTG
GACCTGCGCCGCACCACCTTCTGCGACTGTTCGGGCCTCGGCCTGCTCGCCCGTACGAGC
AGACGCGCGGCCGAGCGCGGCGGCCGGGTCCTGCTGGTCTGCACGCACCCTCTGCAACGG
CGGATCCTCGCCCTCACCGGACTCGACCGGAGCCTGCCGCCGCACACCACCCTCGACGAG
GCGCTGGCGGCGGCCGCGGCCGCACCGGTCAGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002645 STAS domain (Domain)
 [16-125]  7.49999605851445e-24 SSF52091
SSF52091   STAS
 [29-109]  2.9e-12 PF13466
PF13466   STAS_2
 [16-125]  PS50801
PS50801   STAS
 [20-125]  3.2e-23 G3DSA:3.30.750.24
G3DSA:3.30.750.24   STAS
IPR003658 Anti-sigma factor antagonist (Family)
 [19-120]  2.7e-21 TIGR00377
TIGR00377   Ant_ant_sig
SignalP No significant hit
TMHMM No significant hit