close all open/close all

CDS information : Salino_00080


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction7,742 / 8,749 / + [in whole cluster]
7,742 / 8,749 / + [in contig]
Location7742..8749 [in whole cluster]
7742..8749 [in contig]
TypeCDS
Length1,008 bp (335 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)ATP/GTP-binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[ATP/GTP-binding protein]
MIVWINGAFGAGKRSAARELIELIPNSTLFDPEAVRGALARLLPPERARAGEPAIWRRLT
VEALAALHAEVGGVLVVPLGLLRQEHRDEIFGALAARRIGVRHLALAPGETILRARAAAA
RATGAEEGPQQAAADRELYRSALSGWLAADACLIDNSALTPYETAVRIAEAVAGGAAPVT
DIVQTPEPRSQTLASGVLLFDARDRVLLVDPTYKAGWEFPGGVVETGESPALAAVREVAE
ETGLALEGRPRLLVVDWERPAPPGHGGIRLLFDGGRVAEGRQVTLPGGELRDWRFVTEEE
AEALLPPVRFIRLRWALRARAEGAVRYLEDGVPLD
selected fasta
>[ATP/GTP-binding protein]
GTGATCGTCTGGATCAACGGTGCGTTCGGCGCGGGGAAGCGGTCCGCCGCGCGCGAGCTG
ATCGAACTGATCCCGAACAGCACGCTCTTCGATCCCGAGGCGGTCCGCGGCGCGCTGGCC
CGGCTGCTGCCGCCCGAACGGGCGCGGGCGGGCGAGCCGGCCATCTGGCGGCGGCTGACC
GTGGAGGCGCTCGCGGCGCTGCACGCGGAGGTGGGCGGGGTCCTGGTGGTCCCCCTCGGC
CTGCTCCGCCAGGAGCACCGCGACGAGATCTTCGGCGCGCTCGCCGCACGGCGCATCGGC
GTCCGGCATCTGGCGCTCGCACCTGGGGAAACGATCCTGCGGGCACGGGCGGCGGCGGCC
CGCGCCACGGGCGCCGAGGAGGGCCCCCAACAGGCCGCCGCCGACCGGGAGTTGTACCGC
TCGGCACTGTCCGGCTGGCTCGCCGCGGACGCCTGCCTCATCGACAACAGCGCCCTCACC
CCCTACGAGACCGCCGTCCGGATCGCCGAGGCGGTCGCCGGGGGCGCGGCCCCCGTCACC
GACATCGTGCAGACGCCCGAGCCGCGCAGCCAGACGCTCGCCTCGGGCGTGCTGCTCTTC
GACGCGCGGGACCGGGTGCTCCTGGTGGACCCGACGTACAAGGCGGGCTGGGAGTTCCCG
GGCGGGGTCGTCGAGACCGGGGAGTCGCCCGCGCTGGCCGCCGTGCGCGAGGTGGCCGAG
GAGACCGGGCTCGCCCTGGAGGGCAGGCCGCGGCTCCTGGTGGTCGACTGGGAGCGGCCC
GCCCCGCCCGGCCACGGCGGCATCCGGCTCCTCTTCGACGGCGGCCGGGTCGCCGAGGGG
CGCCAAGTGACCCTGCCCGGCGGGGAGTTGCGCGACTGGCGCTTTGTGACCGAGGAGGAG
GCCGAGGCCCTGCTGCCGCCGGTGCGCTTCATCCGGCTGCGCTGGGCGCTGCGGGCCCGA
GCCGAGGGCGCGGTGCGCTACCTGGAGGACGGCGTCCCGCTGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000086 NUDIX hydrolase domain (Domain)
 [190-318]  PS51462
PS51462   NUDIX
 [188-319]  2.80000000000001e-23 G3DSA:3.90.79.10
G3DSA:3.90.79.10   NUDIX_hydrolase
 [193-306]  1e-16 PF00293
PF00293   NUDIX
IPR015797 NUDIX hydrolase domain-like (Domain)
 [175-318]  9.5000102816722e-24 SSF55811
SSF55811   NUDIX_hydrolase
IPR020084 NUDIX hydrolase, conserved site (Conserved_site)
 [222-243]  PS00893
PS00893   NUDIX_BOX
IPR020476 NUDIX hydrolase (Domain)
 [217-231]  5.90000104995095e-07 PR00502 [231-246]  5.90000104995095e-07 PR00502
PR00502   NUDIXFAMILY
SignalP No significant hit
TMHMM No significant hit