close all open/close all

CDS information : Salino_00090


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction10,179 / 8,719 / - [in whole cluster]
10,179 / 8,719 / - [in contig]
Locationcomplement(8719..10179) [in whole cluster]
complement(8719..10179) [in contig]
TypeCDS
Length1,461 bp (486 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)drug resistance transporter EmrB/QacA subfamily
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[drug resistance transporter EmrB/QacA subfamily]
MTTAGQQRLALSVSCAGAMFVALDGTVLMVAQPRLAEDLGASLDQVQWSSTGYLLAVAAL
LVTAGRLGDRYGHPRLLLLGLLGFGAASAGIALAPGIGWVVGLRCLQGVFGALLQPATLA
VLRLSHPPERLGGAVAVRTSAIGLAAAAGPLLGGVLAARLGWRAVFLVNVPVTLAVAALT
LALRLPEPPGDKRPPLGLGGALLLGAALAGLTHTLVGVPAHGWNSAPTLAGSAATALLGA
LFAGHQRRAAEPFLPSAVLRSRAVAASTALLLLASAALFGTLFTCTFVLQDVLGLDPLGA
ALRVLPLTALMVLQAPVAAGLVRRYGARATAAGGVLLLALGAAALSRTAADQGWAGSGPA
YAALGAGFATVLVTATGTVVGDAPPAHAGVVGGLKQTAMNIGPLLGIALATGTLLLASPA
GRALPGADGGASAAGAGATLLLLGAVALLGLAPALLLPARPGRRAEADPAPGSAPRRQSS
GTPSSR
selected fasta
>[drug resistance transporter EmrB/QacA subfamily]
GTGACCACCGCCGGGCAGCAGCGGCTCGCCCTGTCGGTCAGCTGCGCCGGAGCGATGTTC
GTCGCCCTGGACGGCACGGTCCTGATGGTGGCGCAGCCGCGTCTCGCCGAGGACCTCGGG
GCGAGCCTGGACCAGGTCCAGTGGAGCAGCACTGGCTATCTGCTCGCCGTGGCCGCCCTC
CTGGTGACCGCCGGACGCCTCGGCGACCGCTACGGGCACCCCCGGCTGCTGCTGCTCGGA
CTGCTCGGCTTCGGCGCCGCCTCGGCCGGGATCGCGCTGGCGCCGGGCATCGGCTGGGTG
GTGGGGCTGCGCTGCCTGCAGGGCGTCTTCGGCGCGCTGCTCCAGCCGGCCACCCTGGCG
GTGCTGCGGCTCAGCCACCCGCCGGAGAGGCTGGGCGGTGCGGTGGCCGTGCGGACCAGC
GCCATCGGGCTCGCGGCCGCCGCCGGGCCGCTGCTCGGCGGTGTGCTGGCCGCCCGGCTC
GGCTGGCGGGCGGTCTTCCTGGTCAATGTCCCGGTGACCCTCGCCGTCGCGGCGCTCACC
CTCGCGCTGCGGCTGCCCGAACCGCCGGGGGACAAGCGGCCCCCACTCGGCCTCGGGGGC
GCCCTGCTGCTGGGCGCCGCGCTGGCGGGGCTCACCCACACCCTGGTCGGCGTCCCCGCG
CACGGCTGGAACTCCGCGCCCACGCTGGCGGGTTCGGCCGCCACCGCGCTGCTCGGCGCG
CTCTTCGCCGGGCACCAGCGCCGTGCCGCCGAGCCCTTCCTCCCCTCCGCCGTCCTGCGC
TCCCGCGCGGTGGCGGCCTCGACCGCCCTGCTGCTGCTCGCCTCGGCCGCCCTGTTCGGG
ACGCTGTTCACCTGCACCTTCGTCCTCCAGGACGTCCTCGGACTCGACCCGCTGGGCGCC
GCGCTGCGCGTCCTCCCGCTGACCGCCCTGATGGTCCTCCAGGCCCCGGTGGCGGCCGGG
CTGGTACGCCGGTACGGGGCGCGCGCCACCGCGGCGGGCGGGGTGCTCCTCCTGGCGCTC
GGTGCCGCGGCCCTGTCGCGGACCGCCGCGGACCAGGGCTGGGCCGGGAGCGGCCCGGCC
TACGCCGCCCTCGGCGCCGGTTTCGCCACCGTGCTGGTCACCGCCACCGGCACCGTGGTG
GGCGACGCGCCCCCGGCCCACGCCGGGGTGGTCGGCGGTCTCAAGCAGACCGCGATGAAC
ATCGGCCCCCTGCTCGGCATCGCCCTGGCCACCGGCACCCTGCTCCTCGCCTCCCCCGCG
GGCCGCGCCCTCCCCGGGGCGGACGGGGGCGCCTCAGCCGCCGGGGCCGGGGCGACGCTC
CTCCTGCTCGGCGCGGTCGCGCTGCTCGGGCTCGCCCCCGCCCTGCTGCTGCCCGCCCGC
CCCGGGCGCCGGGCCGAGGCGGACCCGGCACCCGGCTCCGCACCGCGGCGTCAGTCCAGC
GGGACGCCGTCCTCCAGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [16-406]  4.10000000000004e-48 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-466]  3.39999972437719e-61 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [10-462]  PS50850
PS50850   MFS
SignalP
 [1-36]  0.76 Signal
Bacteria, Gram-positive   
 [1-36]  0.62 Signal
Bacteria, Gram-negative   
 [1-25]  0.868 Signal
Eukaryota   
TMHMM
 [9-31]  Transmembrane (i-o) [46-68]  Transmembrane (o-i) [81-103]  Transmembrane (i-o) [135-157]  Transmembrane (o-i) [164-186]  Transmembrane (i-o) [196-218]  Transmembrane (o-i) [268-290]  Transmembrane (i-o) [300-322]  Transmembrane (o-i) [329-348]  Transmembrane (i-o) [358-380]  Transmembrane (o-i) [401-420]  Transmembrane (i-o) [435-457]  Transmembrane (o-i)
Transmembrane 12