close all open/close all

CDS information : Salino_00100


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction10,865 / 10,176 / - [in whole cluster]
10,865 / 10,176 / - [in contig]
Locationcomplement(10176..10865) [in whole cluster]
complement(10176..10865) [in contig]
TypeCDS
Length690 bp (229 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)TetR family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[TetR family transcriptional regulator]
MPDIPAAPQPQLPSPDAPLRERLIDAGAALVAREGSASVGLREIAREAGVSHGAPRRHFP
THHALLSAVARRGLADLTARFTAATRPTDPPRARLLALSREYVHFAQEQPGMFELMFRHD
LLDSAQHGTGPDAPAPPRLRESTLPLFAGVVQLLAAHRELLPASQRPDLAPELAAAALWS
GLHGLARLWSAGSLPLALDGSRGEEAGAPDRLDELLAAVLDAYAPPADR
selected fasta
>[TetR family transcriptional regulator]
ATGCCCGACATCCCAGCCGCGCCCCAGCCCCAACTCCCGTCCCCGGACGCCCCATTACGA
GAACGCCTCATCGACGCCGGGGCCGCCCTCGTGGCCAGGGAGGGCAGCGCCTCCGTGGGG
CTGCGCGAGATCGCGCGGGAGGCGGGGGTCTCGCACGGCGCCCCGCGCCGCCACTTCCCG
ACGCACCACGCGCTGCTCTCCGCCGTCGCCCGCCGCGGCCTCGCGGACCTGACCGCCCGC
TTCACCGCGGCCACCCGGCCCACCGACCCGCCGCGCGCCCGACTCCTCGCCCTCAGCCGG
GAGTACGTGCACTTCGCGCAGGAGCAGCCCGGCATGTTCGAGCTGATGTTCCGTCATGAT
CTGCTGGACAGCGCCCAGCACGGCACCGGGCCGGACGCACCGGCCCCGCCCCGGCTCCGC
GAGTCGACGCTTCCGCTCTTCGCCGGTGTCGTACAACTCCTCGCCGCACACCGCGAGTTG
CTGCCCGCATCCCAACGCCCCGACCTCGCACCGGAGTTGGCCGCCGCCGCACTCTGGTCG
GGACTGCACGGGCTGGCCCGGCTGTGGTCCGCGGGCAGCCTGCCACTGGCCCTGGACGGC
AGCCGGGGCGAGGAGGCCGGGGCACCGGACCGGCTCGACGAACTGCTCGCCGCCGTCCTG
GACGCGTACGCGCCCCCGGCGGACCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [17-77]  PS50977
PS50977   HTH_TETR_2
 [23-69]  2.1e-10 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [7-95]  1.20000117458134e-16 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [89-215]  3.00000067992871e-17 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [19-222]  7.5e-41 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR025996 WHG domain (Domain)
 [97-194]  9.10000000000001e-16 PF13305
PF13305   WHG
SignalP No significant hit
TMHMM No significant hit