close all open/close all

CDS information : Salino_00110


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction12,366 / 11,047 / - [in whole cluster]
12,366 / 11,047 / - [in contig]
Locationcomplement(11047..12366) [in whole cluster]
complement(11047..12366) [in contig]
TypeCDS
Length1,320 bp (439 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative deacylase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[putative deacylase]
MPRARTELAELVAFKSVADFTQFPRSESERAARWVGDALRAEGFQDVEILDTPDGTQSVY
GLLPGPEGAPTVLLYAHYDVQPPLDEAAWTTPPFTLTDREGRWYGRGAADCKGGLIMHLT
ALRALKANGGVPVSVKIIVEGSEEQGTGGLERYAEQHPELLRADTVVIGDTGNFRVGVPT
VTATLRGMTLVRVQIDTLAGNLHSGQFGGAAPDALAALIRVLDSLRAPDGSTRVDGLTDQ
ETWQGLDYTDEDFRTDARVLDGVELIGSGSVAERLWSRYAVTVLGIDSPSVAGATPSVHA
NAAALVSLRVPPGGDATEATKLLMAHLEAHTPWGARVRSEQVGQGQAFRADTSGPGYTAM
ARAMAVAYPGQEMQIAGQGGSIPLCNTLASLYPEAEILLIGLSEPSASIHAVDESVSPEE
LERMSVAEAVFLRDYATRD
selected fasta
>[putative deacylase]
ATGCCCCGTGCCAGGACGGAGCTGGCGGAACTGGTGGCCTTCAAGTCGGTGGCGGACTTC
ACCCAATTCCCGAGGAGCGAGAGCGAGCGCGCCGCCCGCTGGGTCGGCGACGCCCTGCGC
GCCGAGGGCTTCCAGGACGTGGAGATCCTGGACACGCCGGACGGCACCCAGTCGGTGTAC
GGCCTGCTGCCCGGCCCCGAGGGCGCGCCGACGGTGCTGCTCTACGCCCACTACGACGTG
CAGCCCCCGCTCGACGAGGCCGCCTGGACGACGCCGCCCTTCACCCTGACCGACCGCGAG
GGCCGCTGGTACGGGCGCGGCGCGGCGGACTGCAAGGGCGGGCTGATCATGCACCTCACC
GCCCTGCGCGCCCTCAAGGCGAACGGCGGCGTCCCGGTCTCGGTGAAGATCATCGTCGAG
GGCTCCGAGGAGCAGGGCACCGGCGGCCTGGAGCGCTACGCGGAGCAGCACCCCGAACTG
CTGCGCGCGGACACCGTGGTGATCGGCGACACCGGCAACTTCCGGGTGGGCGTGCCGACC
GTGACCGCCACGCTGCGCGGGATGACCCTGGTCCGCGTCCAGATCGACACCCTCGCGGGC
AATCTGCACTCCGGGCAGTTCGGCGGGGCGGCACCGGACGCGCTGGCCGCCCTCATCCGG
GTACTGGACTCGCTGCGGGCCCCGGACGGCTCGACCCGCGTGGACGGGCTCACCGACCAG
GAGACCTGGCAGGGACTGGACTACACGGACGAGGACTTCCGCACCGACGCCCGGGTCCTG
GACGGCGTGGAGCTGATCGGCTCCGGCTCGGTCGCCGAACGGCTGTGGTCGCGGTACGCG
GTGACCGTGCTCGGCATCGACAGCCCCTCGGTCGCCGGGGCCACCCCCTCGGTCCACGCG
AACGCGGCGGCGCTGGTGAGCCTGCGGGTGCCGCCGGGCGGCGACGCGACGGAGGCCACC
AAGCTCCTGATGGCCCATCTGGAGGCGCACACCCCCTGGGGCGCCCGGGTGCGCAGCGAA
CAGGTCGGCCAGGGGCAGGCCTTCCGCGCCGACACCAGCGGTCCCGGCTACACCGCCATG
GCCCGGGCGATGGCGGTCGCCTACCCGGGCCAGGAGATGCAGATCGCCGGTCAGGGCGGC
TCGATCCCGCTCTGCAACACCCTCGCCTCGCTCTACCCGGAGGCGGAGATCCTCCTCATC
GGCCTGAGCGAGCCCTCGGCCAGCATCCACGCGGTCGACGAGAGCGTCTCGCCCGAGGAG
TTGGAGCGGATGTCGGTGGCCGAGGCCGTCTTCCTCCGCGACTACGCGACCCGCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002933 Peptidase M20 (Family)
 [73-424]  1.1e-23 PF01546
PF01546   Peptidase_M20
IPR011650 Peptidase M20, dimerisation (Domain)
 [191-334]  4.80000000000001e-12 PF07687
PF07687   M20_dimer
SignalP No significant hit
TMHMM No significant hit