close all open/close all

CDS information : Salino_00120


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction12,581 / 13,783 / + [in whole cluster]
12,581 / 13,783 / + [in contig]
Location12581..13783 [in whole cluster]
12581..13783 [in contig]
TypeCDS
Length1,203 bp (400 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative hydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[putative hydrogenase]
MSSENSSDDAQVTWDVVVVGAGPAGASAAYAAAVAGRRVLLLEKASLPRYKTCGGGIIGP
SRDALPPGFELPLRDRVHAVTFSLEGRFARTRRSKQMLFGLVNRAEFDHLLVEHAQKAGA
ELRTGATVARVEQHGPEVPDRRTVAVVLQSGETVLARSVVGADGSASRIGAHVGVKLRQV
DLGLEAEIPVPPTVAEDWAGRALIDWGPLQGSYGWVFPKGDTLTVGVISARGEGGATKRY
LEDFIARLGLAGFTPEVSSGHLTRCRTEDSPLSRGRVLVCGDAAGMLEPWTREGISFALR
SGRMAGEWAVRLAESGDAVDARRQALNYAFAVKAGLGVEMSVGSRMLKVFERKPSLLHAA
ITGFRPAWKAFAKITRGSTTLGEIVRTHPVARRALSALDG
selected fasta
>[putative hydrogenase]
GTGAGCAGCGAGAACTCTTCCGACGACGCCCAGGTGACCTGGGACGTGGTCGTGGTCGGA
GCCGGACCGGCAGGGGCCTCGGCCGCCTATGCGGCGGCCGTGGCGGGACGGCGGGTCCTG
CTCCTGGAGAAGGCCTCGCTGCCCCGGTACAAGACCTGCGGCGGCGGCATCATCGGCCCC
TCGCGCGACGCGCTGCCGCCCGGCTTCGAACTGCCGCTGCGGGACCGGGTGCACGCGGTC
ACCTTCTCCCTGGAGGGCCGCTTCGCCCGTACCCGCCGCTCCAAGCAGATGCTCTTCGGG
CTCGTGAACCGGGCCGAGTTCGACCACCTGCTCGTCGAGCACGCCCAGAAGGCCGGTGCC
GAACTGCGCACCGGCGCCACGGTCGCCCGGGTCGAGCAGCACGGCCCCGAGGTCCCCGAC
CGCCGTACCGTCGCCGTCGTGCTGCAGAGCGGCGAGACGGTGCTCGCCCGCAGCGTGGTC
GGCGCGGACGGCAGCGCCAGCCGGATAGGCGCCCATGTGGGGGTCAAACTGCGGCAGGTC
GACCTCGGCCTGGAGGCGGAGATCCCGGTGCCGCCGACCGTGGCCGAGGACTGGGCGGGC
CGCGCCCTCATCGACTGGGGCCCGCTGCAGGGCAGTTACGGCTGGGTCTTCCCCAAGGGC
GACACCCTGACCGTGGGCGTGATCTCGGCGCGCGGCGAGGGCGGGGCGACCAAGCGGTAC
CTGGAGGACTTCATCGCGCGGCTCGGCCTCGCGGGCTTCACCCCGGAGGTCTCCTCGGGC
CACCTCACCCGCTGCCGCACCGAGGACTCGCCGCTCTCCCGCGGCCGGGTCCTGGTCTGC
GGGGACGCCGCCGGGATGCTGGAGCCGTGGACCCGGGAGGGCATCTCCTTCGCCCTGCGC
TCCGGGCGGATGGCGGGGGAGTGGGCGGTGCGCCTCGCCGAGTCGGGCGACGCGGTGGAC
GCCCGGCGCCAGGCGCTCAACTACGCCTTCGCGGTCAAGGCCGGGCTCGGCGTGGAGATG
AGCGTCGGCAGCCGCATGCTCAAGGTCTTCGAGCGCAAGCCGAGCCTGCTGCACGCGGCG
ATCACCGGTTTCCGGCCCGCCTGGAAGGCCTTCGCCAAGATCACCCGGGGCTCGACCACG
CTCGGCGAGATCGTACGGACCCACCCGGTGGCCCGGCGGGCGCTCTCGGCCCTGGACGGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [15-37]  1.29999924468179e-12 PR00420 [155-170]  1.29999924468179e-12 PR00420 [274-289]  1.29999924468179e-12 PR00420
PR00420   RNGMNOXGNASE
IPR008671 Lycopene cyclase-type, FAD-binding (Family)
 [15-188]  3.90000000000001e-09 PF05834
PF05834   Lycopene_cycl
IPR011777 Geranylgeranyl reductase (Family)
 [14-309]  9.80000000000012e-81 TIGR02032
TIGR02032   GG-red-SF
SignalP
 [1-31]  0.248 Signal
Bacteria, Gram-negative   
 [1-31]  0.374 Signal
Bacteria, Gram-positive   
 [1-28]  0.103 Signal
Eukaryota   
TMHMM
 [12-34]  Transmembrane (i-o)
Transmembrane 1