close all open/close all

CDS information : Salino_00130


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction13,881 / 15,137 / + [in whole cluster]
13,881 / 15,137 / + [in contig]
Location13881..15137 [in whole cluster]
13881..15137 [in contig]
TypeCDS
Length1,257 bp (418 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)two component system sensor kinase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[two component system sensor kinase]
MEQQPTGNRGGPSRGAPPLRRLAHWWREPQRAAPEERTGLPWASTLLVTAFVLVGSTFAA
KGQPEREPLDLFSRLLLLGGSASLLWRWRFPVPVAFVTAAAAMLYLGAGYPYGPVFLTVA
VGCFSAVLGGHRRAAWSAAGMLWAGHLLVAHWLYRWLPPGGDAPAPWTQEIGIAAWAAAV
IALAELARTKREQWRRERAEREQAARRRADEERLRIARELHDVLAHSISVINVQAGVGLA
LLDSDPEQARTALTTIKAASKEALGEVRQVLDTLRTPGDAPRAPAPGLARLPELVQQAAD
AGLTVEVRTEGGPRPLPPGADLAAFRIVQEALTNVVRHSGSRRARVRLGYEPRALRLVVD
DDGPATGEQAGGSGNGLAGMRERAGALGGTIEAGPREDGGFRVSALLPLATASLEEDR
selected fasta
>[two component system sensor kinase]
ATGGAACAGCAGCCCACCGGGAACCGCGGCGGCCCGTCCCGCGGGGCCCCGCCGCTGAGG
CGCCTGGCCCACTGGTGGCGGGAGCCGCAGCGGGCGGCGCCGGAGGAGCGCACCGGCCTG
CCCTGGGCCTCGACGCTGCTCGTCACCGCCTTCGTGCTCGTCGGCTCGACCTTCGCGGCC
AAGGGCCAGCCCGAGCGCGAGCCGCTCGACCTCTTCTCCCGGCTGCTGCTCCTCGGCGGC
TCGGCCTCGCTGCTGTGGCGGTGGCGCTTCCCGGTGCCGGTCGCCTTCGTGACGGCCGCC
GCCGCGATGCTCTACCTCGGCGCGGGCTATCCGTACGGACCGGTCTTCCTGACGGTGGCG
GTCGGCTGCTTCAGCGCCGTGCTCGGCGGGCACCGGAGGGCGGCCTGGTCGGCGGCCGGG
ATGCTCTGGGCGGGCCATCTCCTGGTGGCGCACTGGCTCTACCGGTGGCTGCCGCCCGGC
GGGGACGCTCCCGCGCCCTGGACCCAGGAGATCGGCATCGCCGCCTGGGCGGCCGCGGTC
ATCGCGCTCGCCGAACTGGCCCGCACCAAGCGGGAGCAGTGGCGGCGCGAGCGCGCCGAA
CGGGAGCAGGCGGCGCGGCGCCGGGCCGACGAGGAGCGGCTGCGGATCGCGCGCGAACTG
CACGATGTGCTGGCGCACAGCATCTCGGTCATCAACGTCCAGGCCGGGGTGGGCCTCGCC
CTCCTCGACTCCGACCCGGAGCAGGCCAGGACCGCCCTGACCACCATCAAGGCGGCCAGC
AAGGAGGCGCTCGGCGAGGTGCGGCAGGTGCTCGACACCCTACGCACGCCGGGCGACGCG
CCGCGCGCGCCCGCGCCCGGCCTCGCGCGCCTGCCGGAACTGGTCCAGCAGGCCGCGGAC
GCCGGCCTCACCGTGGAGGTACGCACCGAGGGCGGCCCCCGGCCGCTGCCCCCGGGCGCG
GACCTCGCCGCCTTCCGTATCGTGCAGGAGGCGCTGACCAATGTCGTACGCCACTCTGGC
TCCCGCCGCGCCCGGGTCCGCCTCGGCTACGAGCCAAGGGCGCTGCGCCTCGTCGTGGAC
GACGACGGGCCCGCCACCGGCGAACAGGCCGGCGGCAGCGGCAACGGGCTCGCCGGGATG
CGGGAGCGGGCCGGGGCCCTCGGTGGCACCATCGAGGCCGGGCCCCGCGAGGACGGCGGC
TTCCGCGTCAGCGCCCTGCTTCCGCTCGCCACCGCTTCCCTGGAGGAGGACCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [281-409]  2.30000440726534e-20 SSF55874
SSF55874   ATP_bd_ATPase
 [319-411]  7.80000016938413e-08 SM00387
SM00387   HATPase_c
 [324-409]  3.5e-10 PF02518
PF02518   HATPase_c
 [294-412]  1.3e-09 G3DSA:3.30.565.10
G3DSA:3.30.565.10   ATP_bd_ATPase
IPR011712 Signal transduction histidine kinase, subgroup 3, dimerisation and phosphoacceptor domain (Domain)
 [212-277]  8.1e-21 PF07730
PF07730   HisKA_3
SignalP
 [1-1]  Signal-anchor
Eukaryota   
 [1-32]  0.291 Signal
Bacteria, Gram-positive   
TMHMM
 [38-60]  Transmembrane (i-o) [106-128]  Transmembrane (o-i) [135-157]  Transmembrane (i-o) [167-186]  Transmembrane (o-i)
Transmembrane 4