close all open/close all

CDS information : Salino_00140


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction15,134 / 15,799 / + [in whole cluster]
15,134 / 15,799 / + [in contig]
Location15134..15799 [in whole cluster]
15134..15799 [in contig]
TypeCDS
Length666 bp (221 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)two component transcriptional regulator, LuxR family
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[two component transcriptional regulator, LuxR family]
MIRVLLADDQSLVRAGFRALLDAQPDIEVAGEAADGEEAVRLVRQLRPDVVLMDIRMPLL
DGLGATRRITEDGQLAAVRVVMLTTFELDEYVFEAIRSGASGFLVKDTEPEELLRAVRAV
TEGDALLSPGVTRRLIAEFAARSKEPAAARSLAALTEREREVMALVGIGLSNEEIARRLV
VSPLTAKTHVSRTMVKLGARDRAQLVVLAYESGLVRPGWLG
selected fasta
>[two component transcriptional regulator, LuxR family]
TTGATCCGCGTACTGCTCGCCGACGACCAGTCGCTGGTCCGGGCGGGATTCCGGGCCCTG
CTCGACGCCCAGCCGGACATCGAGGTGGCGGGCGAGGCCGCCGACGGCGAGGAGGCGGTG
CGCCTGGTGCGCCAACTGCGCCCGGATGTCGTCCTGATGGACATCCGGATGCCGCTGCTC
GACGGACTCGGCGCCACCCGCCGGATCACCGAGGACGGGCAACTCGCCGCGGTGCGCGTG
GTGATGCTGACCACCTTCGAGCTGGACGAGTACGTCTTCGAGGCGATCCGCTCCGGAGCC
TCCGGCTTCCTGGTCAAGGACACCGAGCCCGAGGAACTGCTGCGCGCGGTACGGGCGGTG
ACCGAGGGGGACGCCCTGCTCTCCCCGGGGGTGACCAGGCGGCTGATCGCGGAGTTCGCG
GCCCGCTCCAAGGAACCGGCGGCGGCGCGTTCCCTTGCCGCGCTGACCGAGCGGGAGCGG
GAGGTGATGGCGCTCGTCGGCATCGGCCTGTCCAACGAGGAGATCGCGCGGCGCCTGGTC
GTCAGCCCGCTCACCGCGAAGACCCACGTCAGCCGCACCATGGTCAAGCTGGGCGCCCGG
GACCGGGCCCAACTGGTCGTGCTGGCCTACGAGTCGGGCCTGGTACGGCCGGGCTGGCTG
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [155-169]  1.49999977583352e-11 PR00038 [169-185]  1.49999977583352e-11 PR00038 [185-197]  1.49999977583352e-11 PR00038
PR00038   HTHLUXR
 [148-213]  PS50043
PS50043   HTH_LUXR_2
 [152-209]  9.30000048475975e-26 SM00421
SM00421   HTH_LUXR
 [153-209]  2.1e-16 PF00196
PF00196   GerE
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [3-121]  PS50110
PS50110   RESPONSE_REGULATORY
 [2-117]  2.1000026783403e-33 SM00448
SM00448   REC
 [4-117]  1e-27 PF00072
PF00072   Response_reg
IPR011006 CheY-like superfamily (Domain)
 [1-134]  1.3000049540733e-34 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [125-216]  6.40000000000001e-29 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [133-219]  1e-19 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit