close all open/close all

CDS information : Salino_00160


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction17,627 / 16,101 / - [in whole cluster]
17,627 / 16,101 / - [in contig]
Locationcomplement(16101..17627) [in whole cluster]
complement(16101..17627) [in contig]
TypeCDS
Length1,527 bp (508 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)transmembrane efflux protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[transmembrane efflux protein]
MHAHVLLLPMTSPLTPSAPQERWTPRLWGTLLVLCTAMFLDALDVSMVGVALPSIGTELD
LSTSSLQWIVSGYILGYGGLLLLGGRAADLLGRRRVFLVALGVFAVASVFGGLVDSGPLL
IASRFIKGLSAAFTAPAGLSIITTTFAEGPVRNRALSIYTTCAATGFSMGLVLSGLLTEA
SWRYTMLLPAPIALLALLAGIRLIPRSERQEAGGGYDVPGAVTGTLSMLLLVFTVVQAPE
AGWASARTLLSFLAVAALLALFVRIELRSPSPLVRLGVLRSGSQVRAQLGAMAFFGSYVG
FQFLVTQYMQSLLGWSALQTALAFLPAGALVALSATGIGSVIDRFGTPRLIVLGFASMVL
GYALFLRADLDPQYAAVILPSMLLIGAACALVFPSLNIQATNGVADHEQGMVSGLLNTSI
QVGGALFLAIVTAVVTAGGRQQDTPQQVLDSFRPGLVVVTLVAAAGLLLTLPGLRTRRPA
HSVVVARSAPETAADPAKTAAEPVAARD
selected fasta
>[transmembrane efflux protein]
ATGCACGCGCATGTACTGTTGCTGCCCATGACCTCTCCGCTCACCCCTTCCGCTCCCCAG
GAACGCTGGACACCGCGTCTGTGGGGGACGCTGCTCGTCCTGTGCACCGCGATGTTCCTG
GACGCGCTCGACGTCTCGATGGTGGGAGTCGCCCTCCCCTCCATCGGCACCGAACTCGAC
CTGTCCACCTCGTCCTTGCAGTGGATCGTCAGCGGCTACATCCTCGGCTACGGAGGGCTG
CTGCTGCTCGGCGGCCGCGCGGCCGACCTGCTCGGACGGCGCCGGGTCTTCCTCGTCGCC
CTCGGGGTGTTCGCCGTCGCCTCGGTCTTCGGCGGGCTCGTCGACTCCGGGCCGCTGCTG
ATCGCCAGCCGCTTCATCAAGGGCCTCAGCGCCGCCTTCACCGCCCCGGCGGGACTGTCG
ATCATCACCACGACCTTCGCCGAGGGGCCGGTCCGCAACCGCGCCCTGTCCATCTACACC
ACCTGCGCCGCCACCGGCTTCTCGATGGGCCTGGTCCTCTCCGGCCTGCTCACGGAGGCG
AGTTGGCGCTACACCATGCTGCTGCCCGCGCCGATCGCCCTGCTCGCCCTGCTCGCGGGC
ATCCGGCTCATCCCGCGCAGCGAGCGCCAGGAGGCAGGCGGCGGCTACGACGTCCCGGGC
GCCGTCACCGGCACCCTCTCCATGCTGCTGCTCGTCTTCACCGTGGTCCAGGCGCCCGAG
GCGGGCTGGGCCTCCGCCCGGACCCTGCTCTCCTTCCTCGCCGTCGCCGCGCTGCTCGCC
CTCTTCGTCCGTATCGAACTGCGCAGCCCCAGCCCGCTGGTGCGGCTCGGCGTGCTGCGC
TCCGGCAGCCAGGTCCGCGCGCAGCTGGGCGCCATGGCCTTCTTCGGCTCGTATGTGGGC
TTCCAGTTCCTGGTGACCCAGTACATGCAGTCGCTGCTCGGCTGGTCCGCGCTGCAGACG
GCGCTCGCCTTCCTGCCCGCGGGCGCGCTCGTCGCGCTCTCGGCGACCGGCATCGGCTCG
GTCATCGACCGCTTCGGCACCCCGCGCCTGATCGTGCTGGGCTTCGCCTCGATGGTCCTC
GGCTACGCCCTCTTCCTGCGCGCGGACCTCGACCCGCAGTACGCCGCGGTCATCCTGCCC
TCGATGCTGCTGATCGGCGCGGCCTGCGCCCTGGTCTTCCCCTCGCTCAACATCCAGGCC
ACCAACGGCGTCGCCGACCACGAGCAGGGCATGGTCTCCGGTCTGCTCAACACCTCGATC
CAGGTGGGCGGCGCCCTCTTCCTCGCCATCGTGACCGCGGTGGTCACCGCGGGCGGCCGG
CAGCAGGACACCCCGCAGCAGGTCCTCGACAGCTTCCGGCCCGGCCTGGTCGTCGTCACC
CTGGTCGCCGCCGCCGGACTGCTGCTCACCCTGCCCGGGCTGCGCACCCGCCGCCCGGCG
CACTCCGTGGTGGTCGCCCGCTCGGCACCCGAGACCGCGGCGGACCCGGCGAAGACGGCG
GCGGAACCGGTCGCGGCCCGCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005829 Sugar transporter, conserved site (Conserved_site)
 [84-100]  PS00216
PS00216   SUGAR_TRANSPORT_1
IPR011701 Major facilitator superfamily (Family)
 [34-427]  5.10000000000004e-50 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [10-481]  7.19996395544006e-68 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [30-478]  PS50850
PS50850   MFS
SignalP
 [1-42]  0.657 Signal
Eukaryota   
TMHMM
 [28-50]  Transmembrane (i-o) [65-84]  Transmembrane (o-i) [96-115]  Transmembrane (i-o) [120-142]  Transmembrane (o-i) [155-177]  Transmembrane (i-o) [182-204]  Transmembrane (o-i) [216-238]  Transmembrane (i-o) [243-265]  Transmembrane (o-i) [286-305]  Transmembrane (i-o) [320-342]  Transmembrane (o-i) [349-366]  Transmembrane (i-o) [376-398]  Transmembrane (o-i) [415-437]  Transmembrane (i-o) [452-474]  Transmembrane (o-i)
Transmembrane 14