close all open/close all

CDS information : Salino_00170


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction17,688 / 18,098 / + [in whole cluster]
17,688 / 18,098 / + [in contig]
Location17688..18098 [in whole cluster]
17688..18098 [in contig]
TypeCDS
Length411 bp (136 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)MarR family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[MarR family transcriptional regulator]
MVATHAGDGLVEQWRGILAVHARTMCELDRALHQHGLGASDFEVLDVLATGNESGECSFR
VQEIAGCVHLSQSALSRLIGRLEKDGLVERAMCAEDRRGVSVQLTEKGRALHGEVLPVQR
AVLRRMLDEERTAQHA
selected fasta
>[MarR family transcriptional regulator]
ATGGTGGCGACGCATGCCGGAGACGGACTCGTGGAGCAGTGGCGCGGCATTCTGGCCGTC
CACGCGCGCACCATGTGCGAGCTGGACCGCGCGCTGCACCAACACGGCCTGGGCGCAAGC
GACTTCGAGGTCCTCGACGTCCTCGCGACGGGCAATGAGAGCGGCGAGTGCTCCTTCCGC
GTGCAGGAGATCGCCGGATGCGTGCACCTGAGTCAGAGCGCGCTCTCCCGGCTCATCGGA
CGGCTGGAGAAGGACGGCCTCGTCGAGCGCGCGATGTGCGCCGAGGACCGCCGCGGCGTC
AGCGTCCAGCTCACCGAGAAGGGCCGCGCCCTGCACGGGGAAGTGCTGCCGGTGCAGCGG
GCCGTGCTCCGGCGGATGCTGGACGAGGAGCGGACCGCCCAGCACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000835 Transcription regulator HTH, MarR-type (Family)
 [30-135]  9.80000272130218e-22 SM00347
SM00347   HTH_MARR
 [59-75]  3.7999986264479e-09 PR00598 [76-91]  3.7999986264479e-09 PR00598 [95-111]  3.7999986264479e-09 PR00598
PR00598   HTHMARR
 [1-136]  PS50995
PS50995   HTH_MARR_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [12-128]  6e-31 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR023187 Transcriptional regulator MarR-type, conserved site (Conserved_site)
 [73-108]  PS01117
PS01117   HTH_MARR_1
SignalP No significant hit
TMHMM No significant hit