close all open/close all

CDS information : Salino_00190


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction19,526 / 18,795 / - [in whole cluster]
19,526 / 18,795 / - [in contig]
Locationcomplement(18795..19526) [in whole cluster]
complement(18795..19526) [in contig]
TypeCDS
Length732 bp (243 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MEISAYTGFLDREGRLLAEAAEEAGLDAKVPTCPGWQVRDLVRHTAMVHRWATGFVREGR
TETRPMDGEGGLDGAELLAGFRAGHGALLDALESATPELDCWTFFAAPSPLAFWARRQAH
ETTMHRFDADSARGGTPAPVDGVLAVDGIDELLTGFHGRRRSRVRTPEPRTVHVLTTDEG
ASWSLRLSDGPPVAERGLTGEPDCVLSGPASKLYLALWNRVPFPEITGDARLAALWRETS
AIV
selected fasta
>[hypothetical protein]
ATGGAGATCTCCGCGTACACCGGATTCCTGGACCGCGAGGGCCGCCTCCTCGCCGAGGCG
GCCGAAGAGGCGGGCCTCGACGCCAAGGTGCCCACCTGCCCGGGCTGGCAGGTACGCGAC
CTCGTCCGGCACACCGCGATGGTGCACCGCTGGGCCACCGGCTTCGTCCGCGAGGGCCGC
ACGGAGACCCGGCCCATGGACGGGGAGGGCGGGCTCGACGGCGCGGAGCTGCTCGCCGGC
TTCCGCGCGGGGCACGGCGCGCTGCTCGACGCGCTGGAGTCCGCCACCCCCGAGCTGGAC
TGCTGGACCTTCTTCGCGGCGCCCTCCCCGCTCGCCTTCTGGGCCCGGCGGCAGGCCCAC
GAGACGACCATGCACCGCTTCGACGCCGACTCGGCGCGCGGCGGCACCCCCGCCCCGGTC
GACGGGGTGCTCGCGGTCGACGGCATCGACGAGCTGCTGACCGGCTTCCACGGCCGCAGG
CGCAGCCGGGTCCGCACCCCCGAGCCGCGCACCGTCCACGTCCTCACCACCGACGAGGGC
GCCTCCTGGAGCCTGCGCCTGTCGGACGGACCGCCCGTCGCCGAGCGCGGACTCACCGGC
GAGCCCGACTGCGTGCTCTCCGGCCCGGCCTCCAAGCTCTACCTGGCCCTGTGGAACCGC
GTACCCTTCCCGGAGATCACCGGCGACGCCCGCCTGGCGGCACTGTGGCGGGAGACCTCC
GCGATCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010872 MDMPI C-terminal (Domain)
 [144-234]  2e-14 PF07398
PF07398   MDMPI_C
IPR017517 Conserved hypothetical protein CHP03083, actinobacterial-type (Family)
 [10-220]  1.99999999999999e-27 TIGR03083
TIGR03083   TIGR03083
IPR024344 Mycothiol-dependent maleylpyruvate isomerase, metal-binding domain (Domain)
 [15-129]  9.8e-23 PF11716
PF11716   MDMPI_N
SignalP No significant hit
TMHMM No significant hit