close all open/close all

CDS information : Salino_00210


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction20,569 / 21,444 / + [in whole cluster]
20,569 / 21,444 / + [in contig]
Location20569..21444 [in whole cluster]
20569..21444 [in contig]
TypeCDS
Length876 bp (291 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putave phosphosugar isomerase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[putave phosphosugar isomerase]
MQTELASQPETWTRAAQLAAGNSTALPAAGERVAIVGCGTSWFMGQAYAALREQSGQGET
DAFAASEFPAGRPYDRVIALTRSGTTTEVLELLGHLRGRVRTSAITADPRTPVMEAADDL
VVLDFADERSVVQTRFATTALTLLRAHLGLHTEEAVADARTALAEPLPENLVACSQFTFL
GRGWTVGLANEAALKMREASLSWTEAYPAMEYRHGPISVTTSGTATWMFGQAPEGLAEQV
RGTGAQWVGGTLDPLAELVRAQRLAVAVADARGLDPDSPRHLTRSVILPSA
selected fasta
>[putave phosphosugar isomerase]
GTGCAGACCGAGCTGGCCAGCCAGCCCGAGACCTGGACCCGTGCCGCTCAGCTCGCCGCC
GGGAACAGCACCGCGCTCCCGGCCGCCGGCGAGCGGGTGGCGATCGTGGGCTGCGGCACC
TCCTGGTTCATGGGGCAGGCCTACGCCGCTCTGCGCGAGCAGTCCGGTCAGGGCGAGACG
GACGCCTTCGCCGCCTCCGAGTTCCCGGCCGGCCGCCCCTACGACCGGGTGATCGCCCTC
ACCCGGTCCGGCACCACCACCGAGGTCCTGGAACTGCTCGGGCACCTGCGCGGCCGGGTC
CGCACCTCCGCGATCACCGCGGACCCGCGGACTCCGGTGATGGAGGCGGCCGACGACCTC
GTGGTGCTCGACTTCGCCGACGAGCGCTCCGTCGTGCAGACCCGCTTCGCGACCACCGCG
CTCACCCTGCTCCGCGCCCACCTCGGCCTGCACACCGAGGAGGCCGTCGCCGACGCCCGT
ACCGCGCTCGCCGAGCCGCTGCCCGAAAACCTCGTCGCCTGCTCGCAGTTCACCTTCCTC
GGCCGCGGCTGGACCGTGGGCCTCGCCAACGAGGCGGCCCTGAAGATGCGCGAGGCCTCG
CTCTCCTGGACCGAGGCCTACCCGGCCATGGAGTACCGCCACGGCCCGATCAGCGTCACC
ACCTCCGGCACCGCCACCTGGATGTTCGGCCAGGCCCCCGAGGGTCTCGCCGAGCAGGTC
CGCGGCACCGGCGCCCAGTGGGTCGGCGGCACCCTCGACCCGCTCGCCGAACTGGTGCGC
GCCCAGCGGCTCGCGGTCGCCGTGGCCGACGCCCGCGGCCTCGACCCGGACAGCCCGCGC
CATCTGACGCGGTCGGTCATCCTGCCCTCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001347 Sugar isomerase (SIS) (Domain)
 [31-118]  7.7e-06 PF01380
PF01380   SIS
 [23-160]  PS51464 [167-291]  PS51464
PS51464   SIS
SignalP
 [1-49]  0.223 Signal
Bacteria, Gram-negative   
TMHMM No significant hit