close all open/close all

CDS information : Salino_00220


close this sectionLocation

Organism
StrainDSM 41398
Entry nameSalinomycin
Contig
Start / Stop / Direction21,473 / 22,330 / + [in whole cluster]
21,473 / 22,330 / + [in contig]
Location21473..22330 [in whole cluster]
21473..22330 [in contig]
TypeCDS
Length858 bp (285 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)tagatose-bisphosphate aldolase
Gene
Gene (GenBank)agaY
EC number
Keyword
Note
Note (GenBank)

close this sectionSequence

selected fasta
>[tagatose-bisphosphate aldolase]
MPLAQTGPLVAEAAAAGTAVAAFNVITLEHVEAVVAGAEHAGAPVILQISENAVRYRYGR
LLPLARAAAATAEAAAVPVALHLDHVQSDELLRQAADAGFSSVMYDAARLPYAENLAATR
AAAHWGHGNGLWIEAELGEVGGKDGRPPLDAHAPGARTLPAEAEAFVAESGVDSLAVAIG
SSHAMTSRTASLDHALLGELAAALEVPLVLHGSSGVPDAELAAAVTGGIAKVNVGTALNI
AMTTAIRAYLAAHPEAVDSRKYLSVGREAMVRTVSELITVLRPAA
selected fasta
>[tagatose-bisphosphate aldolase]
GTGCCCCTCGCACAGACCGGCCCGCTGGTCGCCGAGGCCGCCGCGGCAGGCACCGCCGTC
GCCGCCTTCAACGTCATCACCCTCGAACACGTCGAGGCGGTCGTCGCGGGCGCCGAGCAC
GCGGGTGCCCCCGTCATCCTCCAGATCAGCGAGAACGCCGTCCGCTACCGCTACGGACGG
CTGCTCCCGCTCGCCCGGGCCGCCGCCGCCACCGCCGAGGCGGCGGCCGTGCCCGTCGCC
CTGCACCTGGACCATGTGCAGAGCGACGAACTCCTGCGGCAGGCCGCCGACGCCGGGTTC
AGCTCGGTGATGTACGACGCCGCCCGCCTGCCCTACGCGGAGAACCTCGCCGCCACCCGG
GCCGCCGCGCACTGGGGCCACGGCAACGGCCTGTGGATCGAGGCCGAGCTGGGCGAGGTC
GGCGGCAAGGACGGCCGGCCGCCCCTCGACGCGCACGCCCCCGGCGCCCGCACCCTGCCC
GCCGAGGCCGAGGCCTTCGTCGCCGAGTCCGGGGTGGACTCCCTCGCCGTCGCCATCGGC
AGCTCGCACGCGATGACCAGCCGCACCGCGAGCCTCGACCACGCCCTGCTCGGCGAGCTG
GCGGCCGCCCTGGAGGTGCCGCTGGTGCTGCACGGCTCCTCCGGAGTGCCCGACGCGGAG
CTGGCCGCCGCCGTCACCGGCGGCATCGCGAAGGTCAATGTCGGCACCGCCCTCAACATC
GCGATGACCACCGCGATCCGCGCGTATCTGGCCGCCCACCCGGAGGCCGTGGACTCGCGC
AAGTACCTCAGCGTCGGCCGCGAGGCGATGGTGCGGACCGTCAGCGAACTGATCACGGTG
CTGCGGCCCGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000771 Ketose-bisphosphate aldolase, class-II (Family)
 [3-281]  4.40000000000003e-68 TIGR00167
TIGR00167   CbbA
 [1-285]  6.70002630158883e-60 PIRSF001359
PIRSF001359   F_bP_aldolase_II
 [4-282]  1.79999999999998e-80 PF01116
PF01116   F_bP_aldolase
IPR013785 Aldolase-type TIM barrel (Domain)
 [3-282]  1.9e-80 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP
 [1-21]  0.122 Signal
Bacteria, Gram-negative   
 [1-21]  0.884 Signal
Eukaryota   
TMHMM No significant hit